DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP001109

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_322055.4 Gene:AgaP_AGAP001109 / 1282054 VectorBaseID:AGAP001109 Length:709 Species:Anopheles gambiae


Alignment Length:172 Identity:34/172 - (19%)
Similarity:68/172 - (39%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVY--DITEANLNQEFLNDGSIYV 97
            ||..|...:....|:.|....:|:.:.:.....:...|:..|:|  |.....|..|........:
Mosquito    24 NDPNRKAVTPAIATRFLLARKYDITRAMALYEQHELIRQREGLYGFDPQTEPLRTELETGKFTIL 88

  Fly    98 HNKDRDGKPLLILTIKKH-SKSRNQEDLLRILVFWIERLQRDSNLDK--ITIFMDMTGAGLSNLD 159
            ..:|..|..:.:.|...| ..:...:..|:.:|:.::...:.|...|  :....||:.:..||.|
Mosquito    89 PGRDASGAAIALFTANLHYPMTVTHKTTLQGVVYQLDVALQSSETQKAGLVFIYDMSTSKYSNFD 153

  Fly   160 MGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFL 201
            ....:.|:.:.:..||.....:|:...|....|.||:::.|:
Mosquito   154 YDLSQKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRLFV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 22/113 (19%)
AgaP_AGAP001109XP_322055.4 CRAL_TRIO 83..227 CDD:279044 22/113 (19%)
PTPc 414..685 CDD:214550
PTPc 442..685 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.