DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP002065

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_320982.5 Gene:AgaP_AGAP002065 / 1281048 VectorBaseID:AGAP002065 Length:277 Species:Anopheles gambiae


Alignment Length:272 Identity:55/272 - (20%)
Similarity:118/272 - (43%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDQDPT------PEQISQVKTSILQR-----LEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDF 56
            :||.|.      .|:.::::|:.:..     |::.|        ||. |.:....|...|:...:
Mosquito     5 TDQGPVVMVGNGVEETAELRTTSIATVTRWLLDERP--------DLV-IPEGSRLILYFLRTTKY 60

  Fly    57 DVEKCITRLWDNLAWRKSFGVYDITEANLN--------QEFLNDG-SIYVHNKDRDGKPLLILTI 112
            |::|...:|...|..|:.     :||...:        ||.|:.| .:.:|.||...:.::::..
Mosquito    61 DLDKAKRKLMTFLNNREK-----LTEWFKDRDPFRPEIQELLDIGVFLPLHQKDALNRQVVVIRT 120

  Fly   113 KKHSKSRNQEDLLRILVFWIERLQRD--SNLDK-------ITIFMDMTGAGLSN---LDMGFIKS 165
            ..|...::::|    .||.::::..|  .:||:       :.|| ||.|..|.:   |....||.
Mosquito   121 AAHDPEKHKQD----DVFKVDKMILDLLMHLDETVSVHGVVAIF-DMQGVTLGHALQLTPSMIKK 180

  Fly   166 IIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTK-KDIDQYVDKDNCLKI 229
            .:..:| .||..|..:...::|..::....:.::|:..:..:.:.::.| ..::|.:...  |::
Mosquito   181 SVESWE-NYPCKPKLLEFVNVPVHVNIVLNVFRSFMSAKMRERVTISRKGSSLEQSITLP--LEL 242

  Fly   230 WGGNDDYVYKFA 241
             |||.:..|:.:
Mosquito   243 -GGNGESYYELS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/154 (19%)
AgaP_AGAP002065XP_320982.5 SEC14 93..245 CDD:238099 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.