DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and RETM_ANOGA

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_319779.4 Gene:RETM_ANOGA / 1279987 VectorBaseID:AGAP009029 Length:684 Species:Anopheles gambiae


Alignment Length:267 Identity:63/267 - (23%)
Similarity:111/267 - (41%) Gaps:68/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QISQVKTSILQRLEK-------EPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            |::.::.|.|.:|.|       |.| ||.:..           :.:.|:..||.::|....|.::
Mosquito   227 QLTPLQESKLVQLRKRFEHGTSEHP-EPDYQT-----------LLRFLRARDFSIDKATGMLQES 279

  Fly    69 LAWRKS------FGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLIL-----TIKKHSKSRNQE 122
            |.|||.      .|.|. |.|.:.:.|....    |:.|:||:||.||     .:|...||..::
Mosquito   280 LQWRKEQRIDSILGEYK-TPAVVEKYFPGGW----HHHDKDGRPLYILRLGTMDVKGLLKSVGED 339

  Fly   123 DLLRILVFWIE---RLQRDSNLDKI--------TIFMDMTGAGLSNLDMGFIKS---IIGVFETK 173
            :||::.:...|   ||.:::.  |:        .:.:|:.|..:.:|....:|:   ||...||.
Mosquito   340 ELLKLTLHICEEGLRLMKEAT--KLFGKPVWNWCLLVDLDGLSMRHLWRPGVKALLRIIETVETN 402

  Fly   174 YPYVPNYILVHDLPFLLDAAFKLVKTFLP------------PEALKILKVTTKKDIDQYVDKDNC 226
            ||.....:|:...|.:....:.:|.||:.            |:.:.     .:..|:||:|.|..
Mosquito   403 YPETMGRVLIVRAPRVFPVLWTIVSTFIDENTRSKFLFFGGPDCMH-----AEDGIEQYIDTDKI 462

  Fly   227 LKIWGGN 233
            ....||:
Mosquito   463 PSFLGGS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 39/171 (23%)
RETM_ANOGAXP_319779.4 PRELI <104..176 CDD:282550
CRAL_TRIO_N 233..279 CDD:215024 13/57 (23%)
CRAL_TRIO 304..469 CDD:279044 40/175 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.