DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP005387

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_315397.4 Gene:AgaP_AGAP005387 / 1276089 VectorBaseID:AGAP005387 Length:325 Species:Anopheles gambiae


Alignment Length:247 Identity:51/247 - (20%)
Similarity:98/247 - (39%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            |.:...:.::|::..|.:           ||...|..||:. ::.:.|:...:.|......|...
Mosquito    36 DDEIREQSLTQMREWIAK-----------HPYIRKCRTDAS-FLLRFLRFRKYSVPMACEALERY 88

  Fly    69 LAWRKSFGVY----DITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSR---NQEDLLR 126
            ||.|::|..:    |..:..: :|.|.||......:|.:|:.:::....:.:..:   .||.  |
Mosquito    89 LAMRETFPQWFKNLDCNDPAM-REMLQDGVFTKLGQDAEGRTVILFRFARFNVDKFTSLQEG--R 150

  Fly   127 ILVFWIERLQ--RDSNLDKITIFMDMTGAGLSNL------DMGFIKSIIGVFETKYPYVPNYILV 183
            ..|..||.|.  .:..:....:.:|.||:.|.:.      ||   |..:......||.....:..
Mosquito   151 FTVLLIETLLECEELQIGGFRVLIDYTGSVLKHYGIWGVSDM---KVFMDAINRSYPIRIREVHG 212

  Fly   184 HDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDIDQYVDK-DNCL--KIWGG 232
            ...|....:...|:.||..|: ||. ::|....:::...: ::.|  |.|||
Mosquito   213 AKFPKFAVSLLNLLLTFASPK-LKD-RITCHNSVEEMAKRCESTLLPKEWGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 33/155 (21%)
AgaP_AGAP005387XP_315397.4 CRAL_TRIO_N 41..88 CDD:215024 10/58 (17%)
CRAL_TRIO 115..262 CDD:279044 31/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.