DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP005383

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_315393.4 Gene:AgaP_AGAP005383 / 1276085 VectorBaseID:AGAP005383 Length:328 Species:Anopheles gambiae


Alignment Length:213 Identity:43/213 - (20%)
Similarity:69/213 - (32%) Gaps:76/213 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VHNKDRDGKPLL-ILTIKKHSKSRNQEDLLRILV------FWIERLQ------------------ 136
            :|....|...|| .|.::|.|.....|.|.|.||      .|..:|.                  
Mosquito    61 IHTCRTDASFLLRFLRVRKFSHLAACETLERYLVSRQRFPAWYSKLDTAEPWVQVMIDSEFVVPL 125

  Fly   137 ------------RDSNLD----KIT---IFMDMTGAGLSNLDMGFIKSIIGVF-ETKYPY----- 176
                        |.:|||    ::|   .|..|....:.:.::..|..::.|| ||..|.     
Mosquito   126 GRDELGRVVFLVRYANLDIDRFEVTDQIRFFTMVFETICHDELNQIAGLVCVFDETNVPMRAFAQ 190

  Fly   177 -----VPNYI------------LVH--DLPFLLDAAFKLVKTFLPPEALKILKVTTKKDIDQYVD 222
                 :.|||            .||  :||....|..:.:.:....:....||  ..:.:|::..
Mosquito   191 WSLTDIKNYIDCVTKALPLRVKEVHVVNLPLFGAAVGEWIMSCCSEKLRSRLK--CYRSMDEFAG 253

  Fly   223 KDNCLKI-----WGGNDD 235
            |.|.|.:     :||..:
Mosquito   254 KCNLLSLMPKEYYGGKQE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 42/209 (20%)
AgaP_AGAP005383XP_315393.4 CRAL_TRIO_N 45..92 CDD:215024 9/30 (30%)
CRAL_TRIO 121..269 CDD:279044 28/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.