DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP004339

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_313618.5 Gene:AgaP_AGAP004339 / 1274486 VectorBaseID:AGAP004339 Length:333 Species:Anopheles gambiae


Alignment Length:219 Identity:44/219 - (20%)
Similarity:98/219 - (44%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSF-GVYDITEANLNQ--EFLNDGS 94
            :|..:|...|::.:: |.|:...|.:......:...:..:.:| |.:...:..|.:  :.::.|.
Mosquito    51 NPRIVKIRMDANFFL-KFLRAKKFQIPVVQENIERYVLLKNAFEGAFKNLDCRLPKMAKLIDQGY 114

  Fly    95 IY-VHNKDRDGKPLL-----ILTIKKHSKSRNQEDLLRILVFWIERLQRDSNLDKITIFMDM--- 150
            :: :..:||:|:.::     :..:::::.:    |:|:|.....|.|..|.. ::|..|:..   
Mosquito   115 MFALPERDREGRRVIFYRPGVFDLREYTNA----DMLKIHGICYETLMADEE-NQIRGFIHAGVG 174

  Fly   151 TGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPF--LLDAAFKLVKTF---LPPEAL--KI 208
            ||.||..|.:..||..:.:.:.....:|   :.|...:  .::.|.|:...|   |..:.|  :|
Mosquito   175 TGIGLPYLTLFTIKEAVRIAKNGEKILP---MRHREMYGCNINPAMKVAVDFGMSLISQKLRERI 236

  Fly   209 LKVTTKKDIDQYVDKDNCLKIWGG 232
            ...|..|||:  ::|....|.:||
Mosquito   237 RLYTDIKDIE--LEKRLLPKEYGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 35/157 (22%)
AgaP_AGAP004339XP_313618.5 CRAL_TRIO_N 40..85 CDD:215024 6/34 (18%)
CRAL_TRIO 113..259 CDD:279044 35/156 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.