DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP004200

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_313096.5 Gene:AgaP_AGAP004200 / 1274036 VectorBaseID:AGAP004200 Length:282 Species:Anopheles gambiae


Alignment Length:191 Identity:39/191 - (20%)
Similarity:63/191 - (32%) Gaps:69/191 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWR 72
            |||....:...|:     :|.|..|..:.|         :|..|...|.       :||      
Mosquito   104 TPEGYRVMLAKIV-----DPDASKFSLSSL---------LTLALMCVDI-------QLW------ 141

  Fly    73 KSFGVYDITEANLNQEFLNDGSIYVHNKDRDG------KPLLILTIKKHSKSRNQEDLLRILVFW 131
                          :|..|:|||.:  .|.||      ..|.|.|:|         |||..:...
Mosquito   142 --------------EEGCNNGSILI--IDMDGIHLGHLPKLGIFTLK---------DLLYFIQEG 181

  Fly   132 IERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKS-------IIGVFETKYPYVPNYILVHD 185
            :....:..:|..:..|:|.    :..:...|:|.       :.....|.:||:|.::|..|
Mosquito   182 LPIRLKGLHLANVVPFIDR----IMTMIRPFMKKELLEMLHLHTKMHTLFPYIPQHLLPSD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 24/107 (22%)
AgaP_AGAP004200XP_313096.5 CRAL_TRIO 98..240 CDD:279044 39/191 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.