DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP009385

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_559860.3 Gene:AgaP_AGAP009385 / 1271293 VectorBaseID:AGAP009385 Length:292 Species:Anopheles gambiae


Alignment Length:154 Identity:35/154 - (22%)
Similarity:66/154 - (42%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NKDRDGKPLLILTIKK--HSKSRNQEDLLRI--LVFWIERLQRDSNLDKITIFMDMTGAGLSN-- 157
            |:|:.|:.:|::....  ..|:.:.|.|.|:  |:..:.:|:..:.::.:.:.:|..|..|..  
Mosquito   113 NRDQKGRRVLLVNCGAAWDPKAVSSEQLFRVFFLIHLVAQLEPATQINGVVVVLDFDGLSLKQVK 177

  Fly   158 -LDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDID--- 218
             |...|.|.:|...:...|.....:.:...|::.:..:.|.|.|: .|.||........|:.   
Mosquito   178 ALSPSFSKRLITFIQDAMPLRLKEVHILKQPYIFNMVWALFKPFI-REKLKSRIFFHGNDLSKFH 241

  Fly   219 QYVDKDNCLKIWGGN---DDYVYK 239
            ||:..|.....:|||   .||..|
Mosquito   242 QYISVDRLPADYGGNLPAIDYTGK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/143 (21%)
AgaP_AGAP009385XP_559860.3 CRAL_TRIO_N 33..78 CDD:215024
CRAL_TRIO 108..256 CDD:279044 30/143 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.