DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP009365

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_310041.4 Gene:AgaP_AGAP009365 / 1271280 VectorBaseID:AGAP009365 Length:186 Species:Anopheles gambiae


Alignment Length:156 Identity:25/156 - (16%)
Similarity:66/156 - (42%) Gaps:23/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LKRITDSDLWITKLLQVYDFDVEKCITRL--WDNLAWRKSFGVYDITEANLNQEFLNDGSIYV-H 98
            ||...|.:.::.:.|:...:..|.....|  :.::..:::| :.|.......|..|:|.::.: .
Mosquito    18 LKLPVDDESFMKRFLRPKKYYPESTFEMLKAFYHMKAKQNF-ISDRLTTKSIQNALDDRAVQILP 81

  Fly    99 NKDRDGKPLLILTI--KKHSKSRNQEDLLRILVFWIERLQRDS-----------NLDKITIFMDM 150
            .:|:.|:.:|.:.:  |.:.......:::|.....:|.:.|:.           |.|::::    
Mosquito    82 KRDQHGRRILYMEMGAKWNCTKVPSMEVIRCTNMLMEMVGREPATQLHGIVFVINFDRLSL---- 142

  Fly   151 TGAGLSNLDMGFIKSIIGVFETKYPY 176
              :.:|.....|:|:::...:...||
Mosquito   143 --SHISQFPPKFVKTVVDHGQKHSPY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 15/99 (15%)
AgaP_AGAP009365XP_310041.4 CRAL_TRIO_N 2..47 CDD:215024 5/28 (18%)
CRAL_TRIO 77..>186 CDD:279044 14/96 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.