DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP009312

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_309981.3 Gene:AgaP_AGAP009312 / 1271257 VectorBaseID:AGAP009312 Length:266 Species:Anopheles gambiae


Alignment Length:241 Identity:50/241 - (20%)
Similarity:86/241 - (35%) Gaps:62/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NDLKRITDSDLWITKLLQVYDFDVEKCITRLWD-------NLAW--RKSFGVYDITEANLNQEFL 90
            :|.:|.:| :|::.:.|...|:||::...|:..       |..|  .|....|. ...|.|.:|.
Mosquito    30 DDCERRSD-ELFLCRFLYCCDWDVQEAFGRIVKLIKLKEANPEWFFHKPIATYS-ELLNRNVKFA 92

  Fly    91 NDGSIYVHNKDRDGKPLLILTIKK-HSKSRNQEDLLRILVFWIERLQRD-SNLDK-ITIFMDMTG 152
            .|      .:||.|:.:.|..:.. ...|....||..:...|.|.:..: ..|:. :|..:||:|
Mosquito    93 LD------RRDRRGRRVFITRLGAIDFSSMAVTDLANLDDIWFELMLNELETLESGVTCLIDMSG 151

  Fly   153 AGL--------SNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKT--FLPPEALK 207
            ..|        .|:.:|..|:                   ||..|.:..|.:|.:  |:......
Mosquito   152 YSLKSFRFLTPQNIRIGSAKT-------------------DLLPLKNIEFHVVNSSVFMNAAIAI 197

  Fly   208 ILKVTTKKDIDQ-------------YVDKDNCLKIWGGNDDYVYKF 240
            :..:.:||..||             |:..|.....:||.....:.|
Mosquito   198 LYPMLSKKIKDQVRFHYSNWASLHEYIPADILPAEYGGTAGKTFDF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 32/166 (19%)
AgaP_AGAP009312XP_309981.3 CRAL_TRIO_N <32..61 CDD:215024 8/29 (28%)
CRAL_TRIO 103..236 CDD:279044 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.