DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:260 Identity:54/260 - (20%)
Similarity:108/260 - (41%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPTPEQ---ISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWD 67
            |.:|:|   :::.:.::...|...|.|:             |.::.:.|:..:||::|....|..
Mouse     7 DLSPQQQEALARFRETLQDLLPTLPKAD-------------DYFLLRWLRARNFDLKKSEDMLRK 58

  Fly    68 NLAWRKSFGVYDITEANLNQ----------EFLNDGSIYVHNKDRDGKPL---LILTI--KKHSK 117
            ::.:|        .:.||:|          :..:.|.:  ...|.:|.|:   :|.|:  |....
Mouse    59 HVEFR--------NQQNLDQILTWQAPEVIQLYDSGGL--SGYDYEGCPVWFDIIGTMDPKGLFM 113

  Fly   118 SRNQEDLLRILVFWIERLQRDSNL---------DKITIFMDMTGAGLSNL---DMGFIKSIIGVF 170
            |.:::|::|..:...|.|..:..|         :::.:..||.|..|.:|   .:...:....:.
Mouse   114 SASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQFFAIL 178

  Fly   171 ETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALK---ILKVTTKKDIDQYVDKDNCLKIWGG 232
            |..||.....:::...|.|...||.|||:|:..|..|   ||....|:::.::|..|.....:||
Mouse   179 EANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPVEFGG 243

  Fly   233  232
            Mouse   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 38/161 (24%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 9/58 (16%)
SEC14 77..244 CDD:214706 38/169 (22%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.