DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and sec14l3

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001120265.1 Gene:sec14l3 / 100145318 XenbaseID:XB-GENE-951877 Length:410 Species:Xenopus tropicalis


Alignment Length:256 Identity:50/256 - (19%)
Similarity:106/256 - (41%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQ-ISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWD 67
            |..|..|: :.:.:.::...:.:.||           .:..|.::.:.|:...|:::|....|..
 Frog     7 DLSPKQEEALVKFRENVKDLMPRLPP-----------FSQDDYFLLRWLRARSFNLQKAENMLRK 60

  Fly    68 NLAWRKSFGVYDITE----ANLNQEFLNDGSIYVHNKDRDGKPL------------LILTIKKH- 115
            |:.:||.....::.|    ..:.|::|:.|   :...||:..|:            |:.:..|. 
 Frog    61 NVEFRKQMDSDNVLEKWQPPEVVQKYLSGG---LCGHDREDSPIWYDVIGPLDPKGLLFSASKQD 122

  Fly   116 ---SKSRNQEDLLRILVFWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIK---SIIGVFETKY 174
               :|.|:.|.|........|:|.:  .::.:.:..|:.|.||.:|....::   .|:.:||..|
 Frog   123 LMKTKMRDCEVLHHACRMQSEKLGK--RVEDVVMIYDVEGLGLKHLWKPAVELYGEILQMFEDNY 185

  Fly   175 PYVPNYILVHDLPFLLDAAFKLVKTFLPPEA---LKILKVTTKKDIDQYVDKDNCLKIWGG 232
            |.....:.|...|.|...|:.|:|.||..:.   :.:|....:..:.:|:..:...:.:||
 Frog   186 PEALKRLFVIKAPKLFPVAYNLIKHFLSEDTRRKIMVLGDNWQDVLKKYIAPEELPQYYGG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/163 (21%)
sec14l3NP_001120265.1 CRAL_TRIO_N 13..60 CDD:215024 8/57 (14%)
SEC14 79..248 CDD:214706 36/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.