DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10483 and ERD1

DIOPT Version :9

Sequence 1:NP_648000.1 Gene:CG10483 / 38666 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_010702.4 Gene:ERD1 / 852023 SGDID:S000002822 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:376 Identity:81/376 - (21%)
Similarity:127/376 - (33%) Gaps:115/376 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 QNIMEV-------ASVFGVIWA-CCVLSYIFCDPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEA 361
            |||:.|       ..:...:|. ..:|.:.....|.:.|.......:.:...:.|   :..|..|
Yeast    14 QNILNVPPPQRFIVLIILALWIWTWILKFFLHSNLDVSQVILTRVPHDIRPGYTL---QQLHRTA 75

  Fly   362 RFWAIRILIRVIMAPFC--------FVNFAD---------------------FW----------- 386
            |.:|::| .|:|: ||.        |:|..:                     ||           
Yeast    76 RNFALKI-TRIII-PFHFATVFLFEFMNIIEGPLKNIILIVYFLPLIQCVTIFWFLLKECQIIKY 138

  Fly   387 ---------------------LADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVEYVSL 430
                                 ::|.|.|.....:|.........|.|..|               
Yeast   139 CTRRCLLIESSPRSLRNTYILISDTLTSFAKPLIDFTLFTSLIFREPFTH--------------- 188

  Fly   431 LHPIVAIMPAYFRFAQCIRRYRDTKESFPHLVNAAKYATS---FFVVIFAHKYHTTTDTYPLSKE 492
            ....||::|...|..||:|.||...|: ..|.||.||:.:   .|....:..|..:.:...|...
Yeast   189 FDLSVALLPVLVRLLQCLREYRLLHEA-TLLFNALKYSCNLPILFCTWRSRVYEGSINEERLHHV 252

  Fly   493 NPWFYCWITAAIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFS 557
            ..||      .:.:|.|...||::|||.| ||.. ..|...:..|......|:..|:.|.:|||.
Yeast   253 QRWF------MLINSSYTLFWDVRMDWSL-DSLT-SLRSRSKSAVTLKKKMYHSAILVDFLLRFW 309

  Fly   558 W-------TLSMSLIEAGYI--EGDVMMTILSPLEVFRRFIWNYFRLENEH 599
            |       .|.:...::.||  :|::..     .||.||.||..|:|:.|:
Yeast   310 WLWVYLSQNLKLVAADSDYIFFQGEMQY-----FEVIRRGIWVVFKLDAEY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898
SPX 3..162 CDD:281146
EXS 260..600 CDD:281164 81/376 (22%)
ERD1NP_010702.4 EXS 1..362 CDD:413852 81/376 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1440
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.