DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10483 and VTC2

DIOPT Version :9

Sequence 1:NP_648000.1 Gene:CG10483 / 38666 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_116651.1 Gene:VTC2 / 850544 SGDID:S000001890 Length:828 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:49/164 - (29%)
Similarity:72/164 - (43%) Gaps:33/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65
            |.|...|...:.|.|:..|||||.:|..|     :..|.:....:...|:....:.:|....|||
Yeast     1 MLFGVKLANEVYPPWKGSYINYEGLKKFL-----KEDSVKDGSNDKKARWDDSDESKFVEELDKE 60

  Fly    66 LAKINTFYSEKMAEATRKYGSLRSELTEALEMGHPKKLPAWKRRTPLGKKNVPA----RKIQDLK 126
            |.|:..|       ..:||.:|...|:      |.:|    :..|....|.:.|    |.:::|.
Yeast    61 LEKVYGF-------QLKKYNNLMERLS------HLEK----QTDTEAAIKALDADAFQRVLEELL 108

  Fly   127 LAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKL 160
            ...:|       |.|::.||||||.||:||||||
Yeast   109 SESTE-------LDNFKRLNFTGFAKIVKKHDKL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 45/160 (28%)
SPX 3..162 CDD:281146 48/162 (30%)
EXS 260..600 CDD:281164
VTC2NP_116651.1 COG5036 1..555 CDD:227369 49/164 (30%)
VTC1 662..791 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.