DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13288 and C18D11.1

DIOPT Version :9

Sequence 1:NP_001261455.1 Gene:CG13288 / 38665 FlyBaseID:FBgn0035648 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001370046.1 Gene:C18D11.1 / 176611 WormBaseID:WBGene00007679 Length:263 Species:Caenorhabditis elegans


Alignment Length:101 Identity:25/101 - (24%)
Similarity:45/101 - (44%) Gaps:36/101 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SGSFACA--IYTLVYFGFSTLMFLFYLIEEQDFLLGNRAQPLGESLLEKGDVTVVTVIFNILLLF 77
            |.|:.|:  :||                ||..:...||               .|:::.:|||. 
 Worm    86 STSYHCSLGLYT----------------EELKYSASNR---------------YVSLVIDILLY- 118

  Fly    78 CSILMVLSSVLLILGLQQNKRHLLIPWISFMLGDLL 113
              :.:||:|::|::||....:.||:||...|:.|::
 Worm   119 --VSLVLASIVLLIGLCSYNQWLLLPWAFLMIIDIV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13288NP_001261455.1 DUF4728 75..163 CDD:292485 13/39 (33%)
C18D11.1NP_001370046.1 alpha-crystallin-Hsps_p23-like <64..>113 CDD:412199 10/57 (18%)
DUF4728 122..199 CDD:374176 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR36694
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.