powered by:
Protein Alignment CG13288 and C18D11.1
DIOPT Version :9
Sequence 1: | NP_001261455.1 |
Gene: | CG13288 / 38665 |
FlyBaseID: | FBgn0035648 |
Length: | 273 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370046.1 |
Gene: | C18D11.1 / 176611 |
WormBaseID: | WBGene00007679 |
Length: | 263 |
Species: | Caenorhabditis elegans |
Alignment Length: | 101 |
Identity: | 25/101 - (24%) |
Similarity: | 45/101 - (44%) |
Gaps: | 36/101 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 SGSFACA--IYTLVYFGFSTLMFLFYLIEEQDFLLGNRAQPLGESLLEKGDVTVVTVIFNILLLF 77
|.|:.|: :|| ||..:...|| .|:::.:|||.
Worm 86 STSYHCSLGLYT----------------EELKYSASNR---------------YVSLVIDILLY- 118
Fly 78 CSILMVLSSVLLILGLQQNKRHLLIPWISFMLGDLL 113
:.:||:|::|::||....:.||:||...|:.|::
Worm 119 --VSLVLASIVLLIGLCSYNQWLLLPWAFLMIIDIV 152
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR36694 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.