DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13288 and C18D11.1

DIOPT Version :10

Sequence 1:NP_001261455.1 Gene:CG13288 / 38665 FlyBaseID:FBgn0035648 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001370046.1 Gene:C18D11.1 / 176611 WormBaseID:WBGene00007679 Length:263 Species:Caenorhabditis elegans


Alignment Length:101 Identity:25/101 - (24%)
Similarity:45/101 - (44%) Gaps:36/101 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SGSFACA--IYTLVYFGFSTLMFLFYLIEEQDFLLGNRAQPLGESLLEKGDVTVVTVIFNILLLF 77
            |.|:.|:  :||                ||..:...||               .|:::.:|||. 
 Worm    86 STSYHCSLGLYT----------------EELKYSASNR---------------YVSLVIDILLY- 118

  Fly    78 CSILMVLSSVLLILGLQQNKRHLLIPWISFMLGDLL 113
              :.:||:|::|::||....:.||:||...|:.|::
 Worm   119 --VSLVLASIVLLIGLCSYNQWLLLPWAFLMIIDIV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13288NP_001261455.1 DUF4728 75..163 CDD:374176 13/39 (33%)
C18D11.1NP_001370046.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. <64..>113 CDD:469641 10/57 (18%)
DUF4728 122..199 CDD:374176 12/31 (39%)

Return to query results.
Submit another query.