DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10486 and HXT5

DIOPT Version :9

Sequence 1:NP_647998.2 Gene:CG10486 / 38664 FlyBaseID:FBgn0035647 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_011964.1 Gene:HXT5 / 856496 SGDID:S000001138 Length:592 Species:Saccharomyces cerevisiae


Alignment Length:474 Identity:98/474 - (20%)
Similarity:169/474 - (35%) Gaps:119/474 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 IFFLGSILGGLAYGHFADHCGRVAALVSSCFLALVGSLATSMSTD-FFTFAISRFLVGASYDTCF 300
            ||.:|..:||:......|..||...|::...:..:|.:....|.| ::.:.|.|.:.|.......
Yeast   142 IFNIGCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIIIQIASIDKWYQYFIGRIISGLGVGGIT 206

  Fly   301 TMVYILVLEYVGPKY--RTLVANLSLALFYSPF----TMVMPWIALSAGNWRRFSSFTSLPI--- 356
            .:..:|:.| |.||.  .|||:...|.:.:..|    |........::..||       :|:   
Yeast   207 VLAPMLISE-VSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWR-------VPLGLC 263

  Fly   357 ----VLAMFSFCLLPESARWLVSVGEIDKALEILKNVIEVNKKQVSKEILDL-FEASCTQFYKEE 416
                :..:.....:|||.|:||.||:|::|   .:::...||......::.| .|...:....|.
Yeast   264 FAWSIFMIVGMTFVPESPRYLVEVGKIEEA---KRSLARANKTTEDSPLVTLEMENYQSSIEAER 325

  Fly   417 LDGRDFTVLSIFKRKRMARYMILMILIWMSISLVYDGHVRAASVLDSENIFLFF--TIACATELP 479
            |.|.......:..:.:|.|..::.::|            ::...|..:|.|.::  ||..|..|.
Yeast   326 LAGSASWGELVTGKPQMFRRTLMGMMI------------QSLQQLTGDNYFFYYGTTIFQAVGLE 378

  Fly   480 GNI--LVIL-------------TLDRAGRR----W-------CSFFYTSLSGVFSLLGASFQNRA 518
            .:.  .::|             |:||.|||    |       |...|.|: ||..|    :.|..
Yeast   379 DSFETAIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMICCYVVYASV-GVTRL----WPNGQ 438

  Fly   519 NMRMSALAGR------FFSNICYNIGLQWA-------AEILPTVVRAQGVAFIHT----MGFVAM 566
            :...|..||.      .|...|:  ...||       :|..|..||.:.::....    .||:..
Yeast   439 DQPSSKGAGNCMIVFACFYIFCF--ATTWAPVAYVLISESYPLRVRGKAMSIASACNWIWGFLIS 501

  Fly   567 LMSPPVVYLSKKSLSSTLIVLGALGIFGGLLAL------------FLPETLNHELPETLSDGAQF 619
            ..:|              .:..|:..:.|.:.:            |:|||....|.|.   ...:
Yeast   502 FFTP--------------FITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEV---NEMY 549

  Fly   620 GKNQRIWHMPCCGPGSRKS 638
            .:|...|......|.||::
Yeast   550 EENVLPWKSTKWIPPSRRT 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10486NP_647998.2 2A0119 104..612 CDD:273328 92/446 (21%)
MFS 231..602 CDD:119392 88/436 (20%)
HXT5NP_011964.1 Sugar_tr 89..549 CDD:395036 93/453 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.