DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10486 and GIT1

DIOPT Version :9

Sequence 1:NP_647998.2 Gene:CG10486 / 38664 FlyBaseID:FBgn0035647 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_010022.1 Gene:GIT1 / 850462 SGDID:S000000695 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:499 Identity:92/499 - (18%)
Similarity:167/499 - (33%) Gaps:165/499 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 FAENPSAYINTSLPTIPCKKGYVFEQEGRAFESATMEFGWLCDDDKYATYAQIIFFLGSILGGLA 248
            ||.....|:|.|:..:  .|.:|            ||:|......|.:|.......:|.|.|...
Yeast    53 FALISDGYVNGSMSML--NKVFV------------MEYGKKNYSSKVSTRVSNAALVGIIFGQFF 103

  Fly   249 YGHFADHCGRVAALVSSCFLALVGSL------ATSMSTDFFTFAISRFL----VGASYDTCFTMV 303
            .|..||:..|.:.::.:..:.::||.      .|::...|:...:.|.|    |||.|.|.....
Yeast   104 MGIAADYYSRKSCILVATAILVIGSALCAASHGTTVPGMFWMLTVMRGLVGIGVGAEYPTSTLSA 168

  Fly   304 YILVLEYVGPK---YRTLVANLSLALFYSPFTMVMPWIA--LSAGN------WR----------- 346
            .....||...|   ...:|.||.|| |..||..::..|.  :.:|.      ||           
Yeast   169 NESANEYTTTKRGGILVMVTNLPLA-FGGPFATIIFLIVYKICSGTKHLEAIWRTVFAIGCFWPL 232

  Fly   347 -----RFSSFT-----------SLPIVLA----------------MFSFCLLPESARWLVSVGEI 379
                 |:.:.|           ::|..||                |:.|...|..   :.|...|
Yeast   233 SVFYFRWKTATTEVYEKGRIKRNIPYFLALKFYWKRLLGTCGTWFMYDFVTFPNG---IFSSTII 294

  Fly   380 DKALEILKNVIEVNKKQVSKEILDLFEASCTQFYKEELDGRDFTVLSIFKRKRMARYMILMILIW 444
            ...::...::::|.:..:...:|.:.......:..:.: ||.:|::..|     :.|:|..::  
Yeast   295 SSVIKDQNDLVKVAEWNLLLGVLAVLGVPIGAYLSDRI-GRKYTLMFGF-----SGYIIFGLI-- 351

  Fly   445 MSISLVYDGHVRAASVLDSENIFLFFTIACATELPGNILVILTLDRAGRRWCSFFYTSLSGVFSL 509
              |...||   :...:.....||..|........||::|.:::.:.:.        |::.|||  
Yeast   352 --IGCAYD---QLKKITPLFIIFYAFMNMLGNAGPGDMLGVISSEASA--------TAVRGVF-- 401

  Fly   510 LGASFQNRANMRMSALAGRFFSNI---CY-----NIGLQWAAEILPTVVRAQGVAFIHTMGFVAM 566
                      ..:||:.|:..|.:   |:     |:|.:|                         
Yeast   402 ----------YGLSAVTGKIGSVVGVECFQPIRDNLGARW------------------------- 431

  Fly   567 LMSPPVVYLSKKSLSSTLIVLGALGIFGGLLA-LFLPETLNHEL 609
                            |.|:....|:.|.::. .|:|.:|..:|
Yeast   432 ----------------TFIIAAICGLIGIIITYFFVPHSLESDL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10486NP_647998.2 2A0119 104..612 CDD:273328 92/499 (18%)
MFS 231..602 CDD:119392 78/443 (18%)
GIT1NP_010022.1 MFS_PhT 48..454 CDD:340922 90/492 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.