DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10486 and CG12783

DIOPT Version :9

Sequence 1:NP_647998.2 Gene:CG10486 / 38664 FlyBaseID:FBgn0035647 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001262644.2 Gene:CG12783 / 42019 FlyBaseID:FBgn0038448 Length:493 Species:Drosophila melanogaster


Alignment Length:483 Identity:98/483 - (20%)
Similarity:162/483 - (33%) Gaps:181/483 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 FLGSILGGLAYGHFADHCGRVAALVSSCFLALVGSLATSMSTDFFTFAISRFLVGASYDTCFTMV 303
            |:|.|.....:|:..|..||...|:.:..::.:.|||:..:..|..|.:.||:      ||   :
  Fly    64 FMGIICSSYFWGYITDKKGRRWTLLRTITISNLCSLASMFTVTFTGFFVMRFI------TC---I 119

  Fly   304 YILVLEYVGPKY-------RTLVANLSLALFYSPFTMVM--PW--IALSAG-------------- 343
            ::....:|...|       |.:|.:::....::.|.|:.  .|  :.||:|              
  Fly   120 FVAGPSFVAATYLSEFCSHRIMVRSITHLYMFTGFAMISCPAWATLFLSSGLIEFEEKLVGSLTL 184

  Fly   344 -NWRRFSSFTSLPIVLAMFSFCLLPESARWLVSVGEIDKALEILKNVIEVNKKQVSKEILDLFEA 407
             .||.......||.|:|.....|||||.::|:.:||..:.|:.::.:...|              
  Fly   185 RPWRVLGCLYILPGVVAFLLLLLLPESPKFLLMIGETKRGLDTMEWISRKN-------------- 235

  Fly   408 SCTQFYKEELDGRDFTVLSIFKRKRMARYMILMILIWMSISLVYDGHVRAASVLDSENIFL---- 468
                      .||   .||..:.||:               |.|..||:.....:.:|.|.    
  Fly   236 ----------TGR---TLSEDQMKRL---------------LAYQEHVQVKRRKEHQNFFRSMLD 272

  Fly   469 ------------FFTIACATELPGNILVILTLDRAGRRWCSFFYTSLSGVFSLLGASFQNRANMR 521
                        :||..|.      ::.:|.|...|   ...:||::           :||.|||
  Fly   273 DAMPLVRKPYGGYFTCVCM------VMFVLGLLTHG---LGIWYTAM-----------RNRCNMR 317

  Fly   522 MSALAGRFFSN-------------------IC--------------------YNIGLQWAAE--I 545
            .....|..|..                   :|                    |||  .||:.  :
  Fly   318 QGNTNGMTFCQVLFVPETGPFIETESDLDVVCSDSFKGFNDSFVLGFVYVVLYNI--SWASLFCV 380

  Fly   546 LPTVVRAQGVAFIHTMGFVAMLMSPPVVYLSKKSLSSTLIVLGA-----LGIFGGLLALFLPETL 605
            ...|:....:....|.||:.:..:..::.|      .:|:.|.|     :|:.||.|.:|:|..|
  Fly   381 HKKVMFVFSLVASSTFGFLLIFATNHMLQL------FSLVFLIAFPGIIIGLLGGSLLVFVPTYL 439

  Fly   606 NHELPETLSDGAQFGKNQRIWHMPC-CG 632
            .             ||...|..|.| ||
  Fly   440 R-------------GKALCISLMWCRCG 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10486NP_647998.2 2A0119 104..612 CDD:273328 91/460 (20%)
MFS 231..602 CDD:119392 89/450 (20%)
CG12783NP_001262644.2 synapt_SV2 <2..>310 CDD:130366 63/305 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.