DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10486 and CG3690

DIOPT Version :9

Sequence 1:NP_647998.2 Gene:CG10486 / 38664 FlyBaseID:FBgn0035647 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster


Alignment Length:499 Identity:100/499 - (20%)
Similarity:186/499 - (37%) Gaps:125/499 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IPCKKGYVFEQEGRAFESATMEFGWLCD-----DDKYATYAQIIFFLGSILGGLAYGHFADHCGR 258
            :|...|.|:|....::...:.|    ||     .||....|  |.:.|.|...:.:|:.||..||
  Fly    53 VPAAMGTVYETSTMSYILPSAE----CDLKLSLLDKGILNA--ITYAGMISSAVLWGYLADIKGR 111

  Fly   259 VAALVSSCFLALVGSLATSMSTDFFTFAISRFLVGASYDTCFTMVYILVLEYVGPKYRTLVANLS 323
            ...|:.......:..|..::|.......:.::|.|......|.::...:.|..|.|:|..:. :.
  Fly   112 RNLLIVGYAADTICVLGGALSQSRIQLMVFKYLGGFCMSGPFAVLMTYLTELHGRKHRQRIM-MM 175

  Fly   324 LALFYSPFTMVMPWIA--------------LSAGNWRRFSSFTSLPIVLAMFSFCLLPESARWLV 374
            :.:.:|..|:.:|.:|              ||..:|:.|.:.|:||.:|:...|...|||.::|:
  Fly   176 VGIMFSIATLTLPGLAMLILPETWNIQIWTLSLTSWQFFVAVTALPSLLSFVLFFFFPESPKFLM 240

  Fly   375 SVGEIDKALEILKNVIEVNKKQ-----------------VSKEILD-------LFEASCTQFY-K 414
            |.|...:||:..|.:..:|.::                 |.|...|       .....|.:.. .
  Fly   241 SKGRNREALDAFKFMYHLNSRKPKDSFPIKLLANEVIVPVKKHAKDETIPTELKLPTECVEVQDP 305

  Fly   415 EELDGRDFTVLSIFKRKR---------------MARYMILM----ILIWM-----SIS---LVYD 452
            |..|.:..::.|.|.:.|               :..:.:|:    :.:|:     ||:   .:..
  Fly   306 ENQDSKKSSLRSGFTQLRPLFTKPYLGLSLWVYLLNFCVLLGQNTMRLWLPQLFASINEYENLMS 370

  Fly   453 GHVRAASVLDSENIFLFF----------------TIAC-----ATELPGNILVILTLDRAGRRWC 496
            |..::.|:.   ||..:.                |:.|     .:....|::|      ||..:.
  Fly   371 GESQSTSIC---NILEYSVNRTQSQLEAVTRNDPTVECHVIITPSTYTNNLIV------AGAGFV 426

  Fly   497 SFFYTSLSGVFSLLGASFQNRANMRMSALAGRFFSNICYNIGLQWAAEILPTVVRAQGVAFIHTM 561
            ::          :|.....|...:::...:|...:..| :||:.|::....||..|.  .|: ||
  Fly   427 AY----------MLAGFLVNLVGVKLIMTSGLLIAAGC-SIGMYWSSSAASTVALAS--LFV-TM 477

  Fly   562 GFV-AMLMSPPVVYLSKKSLSSTLIVLGAL-GIFGGLLA-LFLP 602
            |.: |..:....|.|...||.:.::.|..: |..|.||. :|.|
  Fly   478 GSISATSVISASVSLFPTSLRTMIVSLEMMFGRLGSLLGNIFFP 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10486NP_647998.2 2A0119 104..612 CDD:273328 100/499 (20%)
MFS 231..602 CDD:119392 90/460 (20%)
CG3690NP_001284764.1 SP 42..549 CDD:273317 100/499 (20%)
MFS 49..>195 CDD:119392 32/148 (22%)
MFS 419..>550 CDD:119392 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.