DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10486 and T05A1.5

DIOPT Version :9

Sequence 1:NP_647998.2 Gene:CG10486 / 38664 FlyBaseID:FBgn0035647 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:387 Identity:79/387 - (20%)
Similarity:147/387 - (37%) Gaps:92/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KKKSETSLPRRSWETDDYIDFDDLLPMIGQFGRFQIRLFLFMIPFCFITAFVYLGQIFMCLTPPK 140
            ||.:::.....|.:.:..|..:|||..||.:..:.  ||:     .|..||::|..:...::|  
 Worm    49 KKLAQSPNMTSSIKVETSIKVEDLLDQIGIWHPYP--LFI-----TFSMAFLWLLSVMPTMSP-- 104

  Fly   141 YYCYVPELLHTPVELRKELSIPKEKDGSYSRCRMYNTNYTKIHFAENPSAYINTSLPTIPCKKGY 205
                                       ||                         ..|:.||    
 Worm   105 ---------------------------SY-------------------------MAPSSPC---- 113

  Fly   206 VFEQEGRAFESATMEFG---WLCDDDKYATYAQIIFFLGSILGGLAYGHFADHCGRVAALVSSCF 267
              ..:..:|.:...||.   .|.|..:..:   .|||||:.:.|..|...||..||...|::|.|
 Worm   114 --TLDNCSFVTVQNEFNITKTLIDPGEMTS---SIFFLGNGILGQIYAVAADRIGRRPVLIASLF 173

  Fly   268 LALVGSLATSMSTDFFTFAISRFLVGASYDTCFTMV-YILVLE---YVGPKYRTLVANLSLALFY 328
            ::.:..:..:.:..|....|.||..|:.: |..||: :::..|   :.|..|.:::..|...:.|
 Worm   174 ISGLSGIGAAYAPTFEIMLIGRFFQGSCF-TALTMINWVMCCESISFSGHGYASVLFGLCWVIGY 237

  Fly   329 SPFTMVMPWIALSAGNWRRFSSFTSLPIV----LAMFSFCLLPESARWLVSVGEIDKALEILKNV 389
               ..|.| :|:....||.....||:|.|    |.||:   ||||..:||:..:.|..::.::..
 Worm   238 ---CSVSP-LAMYFSTWRYVQLATSVPCVLFGILMMFT---LPESFSFLVAKRKRDDLVKWIEMA 295

  Fly   390 IEVNKKQVSKEILDLFEASCTQFYKEELDGRDFTVLSIFKRKRMARYMILMILIWMSISLVY 451
            ..|..:::..:...:.:.|..:   |:.:....|:..:.:.|.|.....:...:|.....::
 Worm   296 SRVGNEEIDYDADQIVDMSSRE---EDNESLLQTLKLVLQSKLMVTNTAVETFLWKFFDKIF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10486NP_647998.2 2A0119 104..612 CDD:273328 71/359 (20%)
MFS 231..602 CDD:119392 53/229 (23%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 43/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.