DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QC and Qpctl

DIOPT Version :9

Sequence 1:NP_729109.1 Gene:QC / 38663 FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_080387.2 Gene:Qpctl / 67369 MGIID:1914619 Length:383 Species:Mus musculus


Alignment Length:330 Identity:143/330 - (43%)
Similarity:181/330 - (54%) Gaps:28/330 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IGSVVFAAAGLLLLLLPPSHQQATAGNIGSQWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLV 67
            |||:..|...|::..|.|.....|              |.|.|   |:.|..||.|:.|||::|.
Mouse    74 IGSLSEAKLRLVVGQLDPQRLWGT--------------FLRPL---LIVRPPGSSGNLQVRKFLE 121

  Fly    68 QSLNGL--GFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPND-PGFVGA 129
            .:|..|  |:..|:|.|....|: |.|.|.|||.|::|.|...|.||||||||:||.. |.||||
Mouse   122 ATLQSLSAGWHVELDPFTASTPL-GPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLPPFVGA 185

  Fly   130 TDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLAS 194
            ||||||||:||...:.|.|.|.:..:..:.|.|.|:|.|||||.|||...||:|||:|||..:.|
Mouse   186 TDSAVPCALLLELVQALDAMLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQIMES 250

  Fly   195 KRSGSQAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNN 259
            .....    .|..|..||:.|||||:||.:|.|.|.:..|......|..|||.|.....|:.:..
Mouse   251 IPHSP----GPTRIQAIELFVLLDLLGASSPIFFSHFPRTARWFQRLRSIEKRLHRLNLLQSHPQ 311

  Fly   260 MFLSRVSG---GLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNF 321
            ..:....|   |.|:|||.|||...||||||:|||||.|||||.|..||||.|::.|.:|:...|
Mouse   312 EVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLIATPFPAVWHTPADTEANLHPPTVHNLSRILAVF 376

  Fly   322 VYQYL 326
            :.:||
Mouse   377 LAEYL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 133/294 (45%)
QpctlNP_080387.2 M28_QC_like 80..380 CDD:193501 138/321 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8891
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.