DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QC and qpctlb

DIOPT Version :9

Sequence 1:NP_729109.1 Gene:QC / 38663 FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_001921878.1 Gene:qpctlb / 564655 ZFINID:ZDB-GENE-091118-40 Length:391 Species:Danio rerio


Alignment Length:306 Identity:124/306 - (40%)
Similarity:181/306 - (59%) Gaps:20/306 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EVHFNR----TLDSILVPRVVGSRGHQQVREYLVQSLNGL--GFQTEVDEFKQRVPVFGELTFAN 96
            :|::.|    .|..||:.|..||||.:.||:::...|:.|  |:..|||.|....| .|.::|:|
Zfish    89 QVNWERLWYFQLRPILIQRQPGSRGSRAVRKHIFSQLDSLSAGWSVEVDSFISETP-RGPVSFSN 152

  Fly    97 VVGTINPQAQNFLALACHYDSKYFPNDPG-----FVGATDSAVPCAILLNTAKTLGAYLQKEFRN 156
            ::..::|.|...|.||||||||..|:|..     ||||:|||||||::|.....|.|:|:|..:.
Zfish   153 ILAVLDPMAPRRLLLACHYDSKLIPSDASEPQKVFVGASDSAVPCAMMLELVTALDAHLKKHKQL 217

  Fly   157 RSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLAS--KRSGSQAQLAPRNIDRIEVLVLLDL 219
            .|.|.|.|:||||.|||::|:..||:|||:|||..::|  ...||:....   ::.:::||||||
Zfish   218 MSRVTLQLVFFDGGEAFEQWSPTDSLYGSRHLAEYMSSIPHPPGSEQTTL---LNAVDLLVLLDL 279

  Fly   220 IGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGN---NNMFLSRVSGGLVDDDHRPFLDEN 281
            |||.:|.|.:.::||......|:..||.|.|.|.|..:   ...|:..::.|.|:|||.|||...
Zfish   280 IGAADPMFVNHFDNTARWFDRLIAAEKRLHTLGLLSSHPKEQRYFIKDMNMGPVEDDHLPFLQRG 344

  Fly   282 VPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLK 327
            ||||||:|||||...||..|.|..:|..::.|..::...|:.:||:
Zfish   345 VPVLHLIATPFPSFLHTMEDTADKIHRHTVENLTKILVVFLAEYLR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 122/302 (40%)
qpctlbXP_001921878.1 M28_QC_like 81..388 CDD:193501 122/302 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm6584
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.