DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QC and qpct

DIOPT Version :9

Sequence 1:NP_729109.1 Gene:QC / 38663 FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001017245.1 Gene:qpct / 549999 XenbaseID:XB-GENE-953343 Length:359 Species:Xenopus tropicalis


Alignment Length:294 Identity:127/294 - (43%)
Similarity:179/294 - (60%) Gaps:10/294 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FNRTLDSILVPRVVGSRGHQQVREYLVQSLNGL--GFQTEVDEFKQRVPVFGELTFANVVGTINP 103
            |...|..:|..|..||.|:..||:::.|.|..|  |:.||.|.|:...| :|.:||:|::.|:||
 Frog    66 FQTDLKPMLTERYAGSPGNYAVRQHIKQRLQSLQAGWVTEEDTFEAPTP-YGYVTFSNIISTLNP 129

  Fly   104 QAQNFLALACHYDSKYF-PNDPG--FVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLI 165
            .|:..|.|||||||||| |...|  ||||.|:|||||::|..|:.|.:.|:|:..::.|:.|.||
 Frog   130 SAKRHLVLACHYDSKYFSPQWDGRVFVGAIDAAVPCAMMLELARALDSSLKKKLNSKLDLSLQLI 194

  Fly   166 FFDGEEAFKEWTDADSVYGSKHLAAKLASKRSGSQAQLAPRNIDRIEVLVLLDLIGARNPKFSSF 230
            ||||||||:.|:..||:|||||||.|:.:......|: ....:..|::.:||||||..||.|.::
 Frog   195 FFDGEEAFQRWSSYDSLYGSKHLAQKMETISHPPNAE-NTNQLHGIDLFILLDLIGTANPVFPNY 258

  Fly   231 YENTDGLHSSLVQIEKSLRTAGQLEGNNN---MFLSRVSGGLVDDDHRPFLDENVPVLHLVATPF 292
            ::||....:.|..||:.|.....|:.:.:   .|.|......|.|||.|||...||:|||:.:||
 Frog   259 FQNTARWFNRLQSIERRLHGLNLLKNHPSEVQYFQSGFRARPVLDDHVPFLQRGVPILHLIPSPF 323

  Fly   293 PDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYL 326
            |:||||..||..||...:|.|.|::.:.||.:||
 Frog   324 PEVWHTMEDNEENLDSATIENLNKILQVFVLEYL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 125/291 (43%)
qpctNP_001017245.1 M28_QC_like 51..356 CDD:349876 125/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm9550
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.