DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QC and isoQC

DIOPT Version :9

Sequence 1:NP_729109.1 Gene:QC / 38663 FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster


Alignment Length:303 Identity:133/303 - (43%)
Similarity:185/303 - (61%) Gaps:28/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTI 101
            |::|....:|.||:|||||:..|..||||:||||..|.:..||:.|....|:.|:|.|.|::.|:
  Fly    60 DKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNIIATL 124

  Fly   102 NPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEFR--NRSDVGLML 164
            ||.|:.:|.|:|||||||.|. ..|:||||||||||:|||.|:.    ||::.:  .:|.:.|||
  Fly   125 NPNAERYLVLSCHYDSKYMPG-VEFLGATDSAVPCAMLLNLAQV----LQEQLKPLKKSKLSLML 184

  Fly   165 IFFDGEEAFKEWTDADSVYGSKHLAAKLASKRSGSQAQLAPRNIDRIEVLVLLDLIGARNPKFSS 229
            :||||||||:||...||:||::|||.|...:          ..:|||::||||||:||.:|.|.|
  Fly   185 LFFDGEEAFEEWGPKDSIYGARHLAKKWHHE----------GKLDRIDMLVLLDLLGAPDPAFYS 239

  Fly   230 FYENTDGLHSSLVQIEKSLRTAGQLE----------GNNNMFLSR-VSGGLVDDDHRPFLDENVP 283
            |:|||:..:..:..:|..|.....||          .....|.|: :....::|||.|||..|||
  Fly   240 FFENTESWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRSSFIEDDHIPFLRRNVP 304

  Fly   284 VLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYL 326
            :|||:..|||.|||||.|||:.:.:.:..|...:.|.|..:||
  Fly   305 ILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 131/300 (44%)
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 131/300 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445050
Domainoid 1 1.000 168 1.000 Domainoid score I792
eggNOG 1 0.900 - - E1_KOG3946
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I487
Isobase 1 0.950 - 0.861353 Normalized mean entropy S1680
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117458at50557
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm6584
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - P PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
1211.750

Return to query results.
Submit another query.