DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QC and CG6168

DIOPT Version :9

Sequence 1:NP_729109.1 Gene:QC / 38663 FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster


Alignment Length:317 Identity:130/317 - (41%)
Similarity:176/317 - (55%) Gaps:25/317 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QATAGNIGSQWR-----DDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFK 83
            :.|..|:| |.|     .|..:..:.:..|.:.|.|.:.||.:||.|:|..|..|.:..|:|.|.
  Fly    42 EPTELNLG-QMRMIAGLSDPENLRKNVQRIAIKRAVSTPGHSEVRNYIVDYLKKLNWNVELDIFT 105

  Fly    84 QRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGA 148
            |:||:...:||.|:|...|||.|.:|...|||||||| .|..|:.|||||||||::||.|    .
  Fly   106 QKVPIMSNVTFHNIVARQNPQTQRYLMFGCHYDSKYF-KDFDFMAATDSAVPCALMLNMA----T 165

  Fly   149 YLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASKRSGSQAQLAPRNIDRIEV 213
            .|:.:| :||.|.|||:||||||||.||:..||.|||:|| |:|..|..         .:|:|::
  Fly   166 ILKHQF-HRSQVSLMLVFFDGEEAFGEWSQEDSPYGSRHL-AELWEKHG---------FLDKIDL 219

  Fly   214 LVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGL-VDDDHRPF 277
            .||.|||||::..|.....:|.|....|||:|..|..||.:.....:|  :...|: |||||.||
  Fly   220 FVLPDLIGAKDVVFKKNILDTSGWFHRLVQLELKLFQAGIVRSERPLF--KFEPGIDVDDDHLPF 282

  Fly   278 LDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVN 334
            ...||||:||::..:|.|||...|...|:.:.:......|.|.||.:||....|..|
  Fly   283 TRRNVPVIHLISNKYPAVWHQAEDVEMNVDYNTTEQVGLVLRMFVMEYLNSAPSISN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 121/289 (42%)
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 124/299 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445047
Domainoid 1 1.000 168 1.000 Domainoid score I792
eggNOG 1 0.900 - - E1_KOG3946
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I487
Isobase 1 0.950 - 0.861353 Normalized mean entropy S1680
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117458at50557
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - otm46906
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
1110.850

Return to query results.
Submit another query.