DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QC and QPCT

DIOPT Version :9

Sequence 1:NP_729109.1 Gene:QC / 38663 FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_036545.1 Gene:QPCT / 25797 HGNCID:9753 Length:361 Species:Homo sapiens


Alignment Length:320 Identity:134/320 - (41%)
Similarity:187/320 - (58%) Gaps:31/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QQATAGNIGSQWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGL--GFQTEVDEFKQR 85
            |.|...:|...|::|       |..:|:.|..||.|....|::::|.:..|  .:..|:|.|..:
Human    55 QIAEGTSISEMWQND-------LQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQ 112

  Fly    86 VPVFGELTFANVVGTINPQAQNFLALACHYDSKYFP--NDPGFVGATDSAVPCAILLNTAKTLG- 147
            .| :|..:|:|::.|:||.|:..|.||||||||||.  |:..||||||||||||::|..|:.|. 
Human   113 TP-YGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDK 176

  Fly   148 --AYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLAS------KRSGSQAQLA 204
              ..|:....::.|:.|.||||||||||..|:..||:|||:|||||:||      .|..||    
Human   177 KLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQ---- 237

  Fly   205 PRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNN---NMFLSRVS 266
               :..:::|||||||||.||.|.:|:.|:......|..||..|...|.|:.::   ..|.:...
Human   238 ---LHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSY 299

  Fly   267 GGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYL 326
            ||::.|||.|||...||||||:.:|||:||||..||..||...:|.|.|::.:.||.:||
Human   300 GGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 128/304 (42%)
QPCTNP_036545.1 M28_QC_like 51..358 CDD:193501 132/317 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861353 Normalized mean entropy S1680
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.670

Return to query results.
Submit another query.