DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and SV2A

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001315603.1 Gene:SV2A / 9900 HGNCID:20566 Length:742 Species:Homo sapiens


Alignment Length:690 Identity:116/690 - (16%)
Similarity:208/690 - (30%) Gaps:278/690 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ELEGLPESEQKNRGIPKKQDGSFENCFMYNVPYDSNATNDANQTRSPIPCNNGWIYDRKEVPYES 124
            |.:|:|.:|...:| .:..||:         |. :......:....| |...|....|||  .|.
Human    97 EYQGIPRAESGGKG-ERMADGA---------PL-AGVRGGLSDGEGP-PGGRGEAQRRKE--REE 147

  Fly   125 IATEYNWVCDKRDFGTYSVVVYFV----------------------------------------- 148
            :|.:|..:..:...|.:...:|||                                         
Human   148 LAQQYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVY 212

  Fly   149 -GCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIY 212
             |.:||...:|.:.|..||...|.::.|.:.:....|...:.:..|...|.::|:.:... :||.
Human   213 LGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGS-IPIV 276

  Fly   213 ------ILTLENVGIKYRTLVGNLA-LTFFFTLG---ACLLPWL-------------AYVISNWR 254
                  .|..|..|       .:|: |..|:.:|   |..:.|.             ||...:||
Human   277 FSYFSEFLAQEKRG-------EHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWR 334

  Fly   255 HYAMVVALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEA----AKANG-----------KI 304
            .:.:|.|.|.||.|......||||.:.:..||.|....|:|:.    .:|.|           |.
Human   335 VFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKT 399

  Fly   305 ISEE---------------------------VWSEMRECYELKFANEQLGKQYTSLDLFKTFPRL 342
            |.:|                           ||.....|:         |.:|..:.|       
Human   400 IHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCF---------GPEYRRITL------- 448

  Fly   343 VVLTILIVTWMTVALAYDA----------HVRVVE------------------------------ 367
                :::..|.|::.:|..          |::.|:                              
Human   449 ----MMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGERVEHVTFNFTLENQIHRGG 509

  Fly   368 ----------------------------------------------ILDTDI------------- 373
                                                          ..:||:             
Human   510 QYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINS 574

  Fly   374 ------------------------FITFSLSSLVEIPAGIVPMLLLDRIGRKPMMSAVMLLCAAS 414
                                    |::| |.:|..:|..||..||:|:|||..|::...::...|
Human   575 TFLHNKEGCPLDVTGTGEGAYMVYFVSF-LGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVS 638

  Fly   415 SLFVGILKGHWNASTAAIAARF--FATMAYNVGQQWASEILPTVLRGQGLAIINIMGQMGALLSP 477
            ..|:..  |:..::..|:...|  .:..::|.......|:.|:..|......:|.:.::.|:|..
Human   639 CFFLSF--GNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGI 701

  Fly   478 LVLSTH-RYYRPLPMFIITLVSVIGALIILFLPETKGATM 516
            .:.::. ...:..|:...:....:|:.:.|.||||:|..:
Human   702 SIFTSFVGITKAAPILFASAALALGSSLALKLPETRGQVL 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 116/690 (17%)
MFS 141..509 CDD:119392 93/600 (16%)
SV2ANP_001315603.1 synapt_SV2 1..742 CDD:130366 116/690 (17%)
Interaction with SYT1. /evidence=ECO:0000250 1..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..144 12/58 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.