DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and OCT1

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_565059.2 Gene:OCT1 / 843656 AraportID:AT1G73220 Length:539 Species:Arabidopsis thaliana


Alignment Length:552 Identity:119/552 - (21%)
Similarity:215/552 - (38%) Gaps:156/552 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NVPYDSNATNDANQTRSPIPCNN------------------------------GWIYDRKEV--- 120
            |:..||:||.....||.....||                              .||:|.:..   
plant    17 NISNDSSATEKGEATRQQQLPNNRYALTVDEVIEQHIGALGFAQILHALLVSIAWIFDAQTTLIS 81

  Fly   121 ------------------------------------PYESIATEYNWVCDKRDFGTYSVVVYFVG 149
                                                ..:::.:|:|.:|..:........::|:|
plant    82 IFSDAQPAARLLATGAIVEGASLCGLASGEWEWIGPKSDTVVSEWNLICQHKFLVAVPSTLFFIG 146

  Fly   150 CIVGCLCFGFITDH-SGRLPALFLANSCSMIGGCVSVVCKDFP--------CFAASRFVAGL--- 202
            .:.|...:|::.|. .||...|.|:        ||......|.        .:|..||..|.   
plant   147 SLFGSGVYGYLADSWFGRKKTLLLS--------CVLTFVTAFAISFSPNVWVYAFLRFANGFFRS 203

  Fly   203 SMNYCFVPIYILTLENVGIKYRTLVGNLALTFFFTLGACLLPWLAYV-ISNWRH-YAMVVALPIV 265
            .:..|.:   :|..|.||.|:|..||.... ||||||...||.:||: ..:||: |.::..||:.
plant   204 GIGSCCI---VLATEIVGKKWRGQVGQYGF-FFFTLGFLSLPLMAYLERKSWRNLYRIISFLPLG 264

  Fly   266 FMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKII-------------------SEEVWS 311
            :.:.....|.|||.||:..|:....:.|:|:.|:.|||.:                   ||:.| 
plant   265 YAVCLLPFAYESPRWLLVKGRNKEAMVVLKKLARLNGKQLPADLSLVDPIPERDDQTSSSEKFW- 328

  Fly   312 EMRECYELKFANEQLGKQYTSLDLFKTFPRLVVLTILIVTWMTVALAYDAHVRVVEILDTDIFIT 376
                  :.|:|.::                  ::.:::..:.:..:.|...:. .|.|:.::::|
plant   329 ------KTKWAVKR------------------IIMVMMAGFGSGFVYYGIQLN-AENLNFNLYLT 368

  Fly   377 FSLSSLVEIPAGIVPMLLLDRIGRKPMMS-------AVMLLCAASSLF-----VGILKGHWNAST 429
            .::::|:|.||..:...||..:.|:|:.|       ...||||..|:.     :.:.|  | ...
plant   369 VAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGFACLLCAVLSIHRVIRAISVAK--W-LQL 430

  Fly   430 AAIAARFFA-TMAYNVGQQWASEILPTVLRGQGLAIINIMGQMGALLSPLVLSTHRYYRPLPMFI 493
            |..|..|.| :.||:|...:..|:.||.:|...::::.....:||..:||:::..|....:...:
plant   431 AVEAVGFMASSTAYDVLYVYCVELFPTNVRNTAVSLLRQAFMLGASAAPLLVALGRESAMMSFIV 495

  Fly   494 ITLVSVIGALIILFLPETKGATMPQTLDEAEK 525
            ..:.||:..::.|:|.||:.|.:.:||.:..|
plant   496 FGVASVLSGIVSLWLRETRNAPLYETLAQQGK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 116/544 (21%)
MFS 141..509 CDD:119392 97/413 (23%)
OCT1NP_565059.2 MFS_OCT_plant 102..511 CDD:340936 100/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.