DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and OCT6

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_173087.1 Gene:OCT6 / 838207 AraportID:AT1G16370 Length:521 Species:Arabidopsis thaliana


Alignment Length:475 Identity:121/475 - (25%)
Similarity:213/475 - (44%) Gaps:55/475 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NCFMYNVPYDSNATNDANQTRSPIPCNNGWIYDRKEVPYESIATEYNWVCDKRDFGTYSVVVYFV 148
            :|..:.: .|.:|::.....||      .|.:|... ..:|:.:|:...|............:::
plant    76 HCLNHTI-CDPSASDICKLPRS------AWEWDGGS-QGKSVISEFGLECSSSLLRGMPSSAFYI 132

  Fly   149 GCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAAS-------RFVAGLSMNY 206
            |.|||......|.|.|.....|.|.::.:|....:||:      |:.:       :|:.|.|.:.
plant   133 GAIVGGFFLALIPDDSLGRKKLVLFSTFAMSITSISVI------FSTNVWIYTFLKFIIGFSRSQ 191

  Fly   207 CFVPIYILTLENVGIKYRTLVGNLALTFFFTLGACLLPWLAYVI--SNWRHYAMVVALPIVF-MI 268
            .:....:|..|.|..::|.....:..| .|.||...|..:|::.  |:||:..:..::|.|| .|
plant   192 TWSYALVLISERVSTRWRPRATMIPFT-LFVLGFMSLSGIAFLAQDSSWRYLYLYTSVPAVFYCI 255

  Fly   269 LTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKIISEEVWSEMRECYELKFANEQLGKQYTSL 333
            ...|.|.|||.||...||....|:|:.:.:... |...|.|.|::    .||..|.:....|:..
plant   256 FLYLFALESPRWLHMQGKDKEAIDVLTKMSPKE-KAYLESVVSKL----PLKQENFEQAPTYSIK 315

  Fly   334 DLF---KTFPRLVVLTILI----VTWMTVALAYDAHVRVVEILDTDIFITFSLSSLVEIPAGIVP 391
            |.|   ..|.|::|:.|::    :::..|.||       ...:|.:|:::.:|::|||:|..::.
plant   316 DFFFRKWAFRRILVVMIIMFGLGISYYGVPLA-------ARDIDVNIYLSETLNALVELPTFVIT 373

  Fly   392 MLLLDRIGRKPMMSAVMLLCAASSL--FVGILKGHWNASTAAIAARFF-ATMAYNVGQQWASEIL 453
            .:||:|..|:..:....||..||.:  ||..:.|....:.|.....|| |.:.:|:...:..|:.
plant   374 PILLERFNRRSSVLVNTLLGGASGVLCFVLSILGKTEIAFAFELGTFFCARIGFNLMAVFMVEMF 438

  Fly   454 PTVLRGQGLAIINIMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIG-ALIILFLPETKGATMP 517
            ||.:|.....:......:|....||:.|..||. |...|.|..:::.| .:.:|.||||||.::.
plant   439 PTCVRSSATMMFRQALVVGGACCPLIASIGRYI-PSVSFAIFGIAMSGLGMFVLILPETKGLSLC 502

  Fly   518 QTLDEAEKRWTLRCRDRKIN 537
            .:::|.||      ||:.:|
plant   503 DSMEEQEK------RDQAVN 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 115/455 (25%)
MFS 141..509 CDD:119392 99/388 (26%)
OCT6NP_173087.1 MFS_OCT_plant 88..494 CDD:340936 106/432 (25%)
xylE <220..>314 CDD:182225 31/98 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.