DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and SLC22A5

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001295051.1 Gene:SLC22A5 / 6584 HGNCID:10969 Length:581 Species:Homo sapiens


Alignment Length:553 Identity:144/553 - (26%)
Similarity:270/553 - (48%) Gaps:48/553 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YENFLLFIGDFGPFQKRLLFWMMPAAFL-FAFTYFGQIFMILLPKNHWCRVRELEGLPESEQKNR 72
            |:....|:|::|||| ||:|:::.|:.: ..||....:|:|..|: |.|||.:...| .|..:|.
Human     4 YDEVTAFLGEWGPFQ-RLIFFLLSASIIPNGFTGLSSVFLIATPE-HRCRVPDAANL-SSAWRNH 65

  Fly    73 GIP-KKQDGSF--ENCFMYNVPYDSNATN---------DANQTRSPIPCNNGWIYDRKEVPYESI 125
            .:| :.:||..  .:|..|.:...:|.:.         |..|.... .|.:||.:. ::|...:|
Human    66 TVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQE-SCLDGWEFS-QDVYLSTI 128

  Fly   126 ATE------------------------YNWVCDKRDFGTYSVVVYFVGCIVGCLCFGFITDHSGR 166
            .||                        :|.||:.......::.::|||.::|....|.::|..||
Human   129 VTEQDSGAYNAMKNRMGKKPALCLPAQWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGR 193

  Fly   167 LPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIYILTLENVGIKYRTLVGNLA 231
            ...||:..........:.:..|:|..|.....:.|:.....:|..::|..|.:|...|.:...|.
Human   194 KNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLG 258

  Fly   232 LTFFFTLGACLLPWLAYVISNWRHYAMVVALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKE 296
            :..|:..|..:||..||.|.:||...:.:.:|.|..:......||||.||:|.|:.:....::::
Human   259 VCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRK 323

  Fly   297 AAKANGKIISEEVWSEMRECYELKFANEQLGKQYTSLDLFKTFPRLVVLTILIVTWMTVALAYDA 361
            ||||||.::...::...    ||:..:.:..:.:..|||.:|:...:|..:.|:.|||:::.|..
Human   324 AAKANGIVVPSTIFDPS----ELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFG 384

  Fly   362 HVRVVEILDTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKPMMSAVMLLCAASSLFVGILKG--H 424
            .......|..|||:...||::||:||.::..|||..:.|:..|:..:.|..:..||:.::..  :
Human   385 LSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFMQLVPPDLY 449

  Fly   425 WNASTAAIAARFFATMAYNVGQQWASEILPTVLRGQGLAIINIMGQMGALLSPLVLSTHRYYRPL 489
            :.|:...:..:|..|.|:::...:.:|:.|||:|..|:.:.:...::|::|||..:....|.|.|
Human   450 YLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFL 514

  Fly   490 PMFIITLVSVIGALIILFLPETKGATMPQTLDE 522
            |..::..::::.|::.|||||:.|..:|.|:|:
Human   515 PYILMGSLTILTAILTLFLPESFGTPLPDTIDQ 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 140/540 (26%)
MFS 141..509 CDD:119392 96/369 (26%)
SLC22A5NP_001295051.1 2A0119 12..544 CDD:273328 140/540 (26%)
MFS 162..534 CDD:119392 96/375 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9N9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.