DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and SLC22A2

DIOPT Version :10

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens


Alignment Length:145 Identity:23/145 - (15%)
Similarity:50/145 - (34%) Gaps:49/145 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SSAFQEMVIGYQESIGNPDLANFFPFMRFLDLQGNSKKMRESSGRLLQVFREFYDARIVEKSSRS 139
            |||...:...::|:.|:|  .:....:..||..|:..|.||::                      
Human    73 SSAAVGVNAAWEEAPGHP--TDCDQQVLGLDANGDGDKSRENA---------------------- 113

  Fly   140 VEKDVSSKDFLDVLIDLQQGDETEINIDEIEHLLLDMFVAGTDTNSSTVEWAMAELLGNPKTMTK 204
                        .|.|.|:.::|:::...::|...:......||             |..::..:
Human   114 ------------ALPDAQEAEQTDMSTLALDHSEYEPLPENNDT-------------GGNESQPE 153

  Fly   205 VQDEINHVIGQNGDF 219
            .|::...|:.:..:|
Human   154 SQEDPREVLKKTLEF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 MFS_SLC22 113..509 CDD:340875 13/107 (12%)
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 23/145 (16%)
Proline-rich sequence. /evidence=ECO:0000269|PubMed:26979622 284..288
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.