DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and CG31103

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:458 Identity:99/458 - (21%)
Similarity:155/458 - (33%) Gaps:132/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIYI 213
            |..:....:|:|:|..||...|...|..|.....|.:.......|.....:.|:|:......:|.
  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143

  Fly   214 LTLENVGIKYRTLVGNLALTFFFTLGACLLP---WLA-----------YVISNWRHYAMVVALPI 264
            ...|....::|.:..|.: |.|.::.|..:|   ||.           :|...||...:|..||.
  Fly   144 YLSEFNIPRHRAVAINYS-TMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPG 207

  Fly   265 VFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKAN-GKII-----------------SEEVWS 311
            ....|..|..||||.:|:|..|.:..||.:...:|.| ||.|                 .|.:..
  Fly   208 FIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGENLLG 272

  Fly   312 EMREC-------------------YELKFANEQL-GKQYTSLDLFKTFPRLV------------V 344
            |.:.|                   :.....|..| |..::|..:...||.:|            |
  Fly   273 ESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAENNSSTV 337

  Fly   345 LTILIVTWMTVALAYDAHVRVVEILD-TD----------------IFITFSLSSLVEIPAGIVPM 392
            ..||.|.        .....|.|.|| ||                ..|.||:..|:         
  Fly   338 CEILSVP--------VEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLI--------- 385

  Fly   393 LLLDRIGRKPMMSAVMLLCAASSLFVGILKGHWNASTAAIAARFF-------ATMAYNVGQQWAS 450
              |:.:|||.::.|.:.:...|.:.:     |:..|...:...|.       .:::..:|.  ..
  Fly   386 --LNPLGRKNVLLAALAVATLSGVLL-----HFMESPTGVLVLFCLYILLPGLSISIMIGA--IV 441

  Fly   451 EILPTVLRGQG---------LAIINIMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIGALIIL 506
            :::||.||.:.         |.||.....||.:|.|...:|      ..||..||:..|  :|:.
  Fly   442 DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTT------FAMFTCTLIVCI--VIVH 498

  Fly   507 FLP 509
            :||
  Fly   499 YLP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 99/458 (22%)
MFS 141..509 CDD:119392 97/456 (21%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 88/422 (21%)
MFS 34..>189 CDD:119392 23/110 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.