DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and CG7333

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_650814.2 Gene:CG7333 / 42334 FlyBaseID:FBgn0038715 Length:541 Species:Drosophila melanogaster


Alignment Length:519 Identity:174/519 - (33%)
Similarity:267/519 - (51%) Gaps:23/519 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GDFGPFQKRLLFWMMPAAFLFAFTYFGQIFMILLPKNHWCRVRELEGLPESEQKNRGIPKKQDGS 81
            |::|.||..:|........|.:..||.|..:...|: |||...:|.||  |.:..|.:       
  Fly    11 GNYGRFQVMILLLYGYTNILGSLHYFSQTLITFTPE-HWCFHADLNGL--SVEGIRSV------- 65

  Fly    82 FENCFMYNVPYDSNATNDANQTRSPIPCNNGWIYDRKEVPYESIATEYNWVCDKRDFGTYSVVVY 146
            :||....:........|......:...|.| ||::| |..||||.||..|||||..........:
  Fly    66 YENISASSCTPLLGVVNGTGVVSTNRKCRN-WIFNR-ESGYESITTELKWVCDKSHHPAVGQSFF 128

  Fly   147 FVGCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPI 211
            |:|.:||.:.||:::|..||||:|.:|..|...|..::......|.||.|||::|||.:..:..:
  Fly   129 FMGSVVGTIIFGYLSDQVGRLPSLLMATLCGATGDFITSFVHTLPWFAFSRFMSGLSTDTMYYLM 193

  Fly   212 YILTLENVGIKYRTLVGNLALTFFFTLGACLLPWLAYVISNWRHYAMVVALPIVFMILTSLLAPE 276
            |||..|.:..|.||...|:.|..|:..|....||.|..|.|||.|..:.:||.:.:::...|..|
  Fly   194 YILVFEYLSPKSRTFGLNIILAVFYCFGLMTSPWAAIWIGNWRRYLWLASLPALGVLIYPFLICE 258

  Fly   277 SPSWLMSVGKVDRCIEVMKEAAKANGKIISEEVWSEMRECY-ELKFANEQLGK-QYTSLDLFKTF 339
            |..||::..|.|..:..:|:.||.|.:.:.|.|:.|..:.| |.:..:.:|.. :.|.|.:|.| 
  Fly   259 SAQWLLTKRKYDDAVICLKKVAKFNRRHVEESVFDEFVKYYRERELQDYKLNSHEDTFLAMFLT- 322

  Fly   340 PRLVVLTI-LIVTWMTVALAYDAHVRVVEILDTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKPM 403
            |||...|: |:|..:.:.|:.|...|.:|.|.|..|..||.:|:|.:|||:..:||.::||||.|
  Fly   323 PRLRRFTLTLLVKSVIITLSCDVINRNMEGLGTSPFKLFSFTSIVYLPAGVAILLLQNKIGRKGM 387

  Fly   404 MSAVM----LLCAASSLFVGILKGHWNASTAAI---AARFFATMAYNVGQQWASEILPTVLRGQG 461
            ....:    |:..|:...:..|....||...||   ..||.||::|:...|:|:||:||.:|||.
  Fly   388 ACTALFVGGLITTATGFMIAHLDPTENALLLAIMVGLGRFGATVSYDAEIQYAAEIIPTSVRGQA 452

  Fly   462 LAIINIMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIGALIILFLPETKGATMPQTLDEAEK 525
            ::.|:::|...:.|:..|:...:||:|||...|:.:...||.:.|.||||....:|:||.:.||
  Fly   453 VSNIHVIGLASSSLAFYVIYLAQYYKPLPSIFISCLMFFGAGLCLTLPETLNKKLPETLADGEK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 170/511 (33%)
MFS 141..509 CDD:119392 127/377 (34%)
CG7333NP_650814.2 2A0119 11..510 CDD:273328 170/511 (33%)
MFS 126..499 CDD:119392 127/373 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 1 1.010 - - D284622at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
65.960

Return to query results.
Submit another query.