DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and CG12783

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001262644.2 Gene:CG12783 / 42019 FlyBaseID:FBgn0038448 Length:493 Species:Drosophila melanogaster


Alignment Length:476 Identity:95/476 - (19%)
Similarity:168/476 - (35%) Gaps:160/476 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 FVGCIVGCLCFGFITDHSGR----LPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYC 207
            |:|.|.....:|:|||..||    |..:.::|.||:    .|:....|..|...||:..:     
  Fly    64 FMGIICSSYFWGYITDKKGRRWTLLRTITISNLCSL----ASMFTVTFTGFFVMRFITCI----- 119

  Fly   208 FV--PIYI-LTLENVGIKYRTLVGNLALTFFFTLGACLL---PWLAYVISN-------------- 252
            ||  |.:: .|..:....:|.:|.::...:.|| |..::   .|....:|:              
  Fly   120 FVAGPSFVAATYLSEFCSHRIMVRSITHLYMFT-GFAMISCPAWATLFLSSGLIEFEEKLVGSLT 183

  Fly   253 ---WRHYAMVVALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKAN-GKIISEEVWSEM 313
               ||....:..||.|...|..||.||||.:|:.:|:..|.::.|:..::.| |:.:||:....:
  Fly   184 LRPWRVLGCLYILPGVVAFLLLLLLPESPKFLLMIGETKRGLDTMEWISRKNTGRTLSEDQMKRL 248

  Fly   314 ---RECYELKFANEQ---------------------------------------LGKQYTSL--- 333
               :|..::|...|.                                       ||..||::   
  Fly   249 LAYQEHVQVKRRKEHQNFFRSMLDDAMPLVRKPYGGYFTCVCMVMFVLGLLTHGLGIWYTAMRNR 313

  Fly   334 -------------------------------------DLFKTFPRLVVLTILIVTWMTVALA--Y 359
                                                 |.||.|....||..:.|....::.|  :
  Fly   314 CNMRQGNTNGMTFCQVLFVPETGPFIETESDLDVVCSDSFKGFNDSFVLGFVYVVLYNISWASLF 378

  Fly   360 DAHVRVVEILDTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKPMMSAVMLLCAASSLFVGILKGH 424
            ..|.:|:        ..|||     :.:.....||:........:.:::.|.|...:.:|:|.| 
  Fly   379 CVHKKVM--------FVFSL-----VASSTFGFLLIFATNHMLQLFSLVFLIAFPGIIIGLLGG- 429

  Fly   425 WNASTAAIAARFFATMAYNVGQQWASEILPTVLRGQGLAIINIMGQMGALL-SPLVLSTHRYYRP 488
                         :.:.:          :||.|||:.|.|..:..:.||.. :.||.|..:|...
  Fly   430 -------------SLLVF----------VPTYLRGKALCISLMWCRCGAAFGAMLVGSKIQYNCE 471

  Fly   489 LPMFIITLVSVIGALIILFLP 509
            |.:..|:::.:|.|.:..:||
  Fly   472 LFLLAISILPLIAACMEGYLP 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 95/476 (20%)
MFS 141..509 CDD:119392 93/474 (20%)
CG12783NP_001262644.2 synapt_SV2 <2..>310 CDD:130366 56/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.