DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and CG4324

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:431 Identity:95/431 - (22%)
Similarity:182/431 - (42%) Gaps:50/431 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 WIYDRKEVPYESI---ATEYNWVCDKRDFGTYSVVVYFVGCIVGCLCFGFITDHSGRLPALFLAN 174
            |:.|..|:...||   :....|...|....:.:.|| |:|.::....:..:::..||..||.|..
  Fly    66 WMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVV-FLGMMLSSSFWTQLSNRYGRKSALTLFG 129

  Fly   175 SCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIYILTLENVGIKYRTLVGN--LALTFFFT 237
            ...::...:|.|...:......|.:.|.::. |......|..|.:..|::   |.  :.:..|:.
  Fly   130 VLLVLYSILSSVAPSYAWLLTLRGLVGFAIG-CVPQSVTLYAEFLPTKHK---GKCVVLMDCFWA 190

  Fly   238 LGAC---LLPWLAYVISNWRHYAMVVALP-IVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAA 298
            ||||   :|..:.|....||....:.|.| ::|.||:..|: ||..:....|..|:.|:|:::.|
  Fly   191 LGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLS-ESARYYSYNGHNDKAIKVLEQIA 254

  Fly   299 KAN------GKIISEEVWSEMRECYELKFANEQLGKQYTSLDLFKTFPRLVVL----------TI 347
            ..|      |::::::..|    |.| .|      :...|..|::|...|..|          .:
  Fly   255 HNNKRHMLMGRLMADDEPS----CAE-SF------RSLLSPSLYRTTILLWFLWLASAFCYYGLV 308

  Fly   348 LIVTWMTVALAYDAHVRVVEILDTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKPMMSAVMLLCA 412
            |:.|.:.||...::|........|..|:.....:|.|.|..::.:.::...|:|..:....|...
  Fly   309 LVTTELLVARNKESHPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALV 373

  Fly   413 ASSLFVGILKGHWNASTAAIAARFFATMAYNVGQQWASEILPTVLRGQGLAIINIMGQMGALLSP 477
            ..:|.:..::..::.|.....||...:..:.....:..||.|..||..|::..:::.::||:|:|
  Fly   374 LCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTP 438

  Fly   478 LV----LSTHRYYRPLPMFIITLVSVIGALIILFLP-ETKG 513
            .|    :.:.|..   .|....:|.::.::..:||| ||.|
  Fly   439 FVAQVLMDSSRIQ---AMSTYAIVGLLASIACVFLPRETVG 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 95/431 (22%)
MFS 141..509 CDD:119392 83/393 (21%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 94/429 (22%)
MFS 60..471 CDD:119392 90/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.