DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and CG15221

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster


Alignment Length:456 Identity:99/456 - (21%)
Similarity:173/456 - (37%) Gaps:126/456 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 FVGCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAAS-------RFVAGLSM 204
            |:|.::.....||:.|..||...|..|.       |:|.||.....|:.:       ||:.|..:
  Fly    94 FLGVVLSSHAMGFLADTWGRATTLRYAL-------CISSVCSIVSAFSVNIWMLIVFRFLTGFFI 151

  Fly   205 NYCFVPIYILTLENVG----IKYRTLVGN---LALTFFFTLGACLLPW------LAYVISNWRHY 256
            :.....::.|..|..|    |::.||:..   :|:.|...:...:||.      |....|:||..
  Fly   152 SGGQACVFSLCGEFHGTGSRIRHVTLLSGFLCMAMIFAPAMAIGILPLRIETIVLGMHFSSWRVL 216

  Fly   257 AMV-VALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEA-AKANGKIISEEVWSEMRECYEL 319
            .:. |::|::.::..|.| ||:|.:|:..|:.|..:||::.. |..:|:..||         |.:
  Fly   217 LLANVSIPLLALVGISAL-PETPKYLLVQGRGDESLEVLRSIFANNSGRDPSE---------YPV 271

  Fly   320 K-FANEQLGKQYTSLDLFKTFPRLVVLTILIVTW-MTVALAYDAHV----------RVVEILDTD 372
            | .|.|..|...:.:..|....|||        | .||.|.|.|.:          .::..|...
  Fly   272 KEVALESGGVSLSDVHGFLDAVRLV--------WHQTVPLFYRARLWHTLNICCIQFIIYFLAQG 328

  Fly   373 IFITF---------------------------------SLSSLVEIPAGIVPML----------- 393
            ||:.|                                 :.|..||:......::           
  Fly   329 IFMWFPTILDELGTRNGENTLLCTVLQGFNINSSSEDEASSCSVEVDTSTYQVMIIIAACFVVIY 393

  Fly   394 -----LLDRIGRKPMMSAVMLLCAASSLFVGILKGHWNASTAAIAARFFATMAY-NVG---QQWA 449
                 ::|.:|:|.::.|.|:|     ..:.::..|:....|.:.......||. |.|   ...|
  Fly   394 LIFAYIIDYMGKKNLLMAWMVL-----TMICLVALHYVEQFALVVIALTVVMAIGNCGGLVSTIA 453

  Fly   450 SEILPTVLRGQGLAIINIMGQMGALLSPLVLSTHRYYRPLPMF-----IITLVSVIGALIILFLP 509
            .|..||.:...|:..|.::|::||::...:|....:....|:|     ::.|:..:|    .|||
  Fly   454 MEFYPTHINAMGMCFIMMVGRLGAVVGSNILGRLLFASCDPIFWALLALVVLLCTLG----YFLP 514

  Fly   510 E 510
            |
  Fly   515 E 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 99/456 (22%)
MFS 141..509 CDD:119392 96/453 (21%)
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 91/423 (22%)
MFS 51..488 CDD:119392 91/423 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.