DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and Slc22a17

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_803156.2 Gene:Slc22a17 / 305886 RGDID:631405 Length:520 Species:Rattus norvegicus


Alignment Length:453 Identity:101/453 - (22%)
Similarity:179/453 - (39%) Gaps:68/453 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CNNGWIYDRKEVPYESIATEYNWVCDKRDFGTYSVVVYFVGCIVGCLCFGFITDHSGR----LPA 169
            |...|.|:...|...:...:::.|||.........:::.:|...|.|..|:..|..||    |..
  Rat    70 CLKDWDYNGLPVLTTNAIGQWDLVCDLGWQVILEQILFILGFASGYLFLGYPADRFGRRGIVLLT 134

  Fly   170 LFLANSCSMIGGCVSVVCKDFPCFAAS-------RFVAGLSMNYCFVPIYILTLENVGIKYR--- 224
            |.|...|. :||..          |.|       ||:.|..:....:.:|::.||......|   
  Rat   135 LGLVGPCG-VGGAA----------AGSSTGIMTLRFLLGFLLAGVDLGVYLMRLELCDPTQRLRV 188

  Fly   225 TLVGNLALT--FFFTLGACLLPWLAYVISNWRHYAMVVALPIVFMILTSL--LAPESPSWLMSVG 285
            .|.|.|...  .|..||      ||.|..:||....::..|.:..:....  |..||..||:...
  Rat   189 ALAGELVGVGGHFLFLG------LALVSKDWRFLQRMITAPCILFLFYGWPGLFLESARWLIVKR 247

  Fly   286 KVDRCIEVMKEAAKAN---GKIISEEVWSEMRECYELKFANEQLGKQYTSLDLFKTFPRLVVLTI 347
            :::....|::..|:.|   |:::.||....::|.           :....|....||....:|..
  Rat   248 QIEEAQSVLRILAERNRPHGQMLGEEAQEALQEL-----------ENTCPLPTTSTFSFASLLNY 301

  Fly   348 ------LIVTWMTVALAYDAHVRVVEI----LDTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKP 402
                  |::...|..:|:........:    ..:|.::...|:|.....|.:...:.:||.||:.
  Rat   302 RNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRG 366

  Fly   403 MMSAVMLLCAASSLFVGILKGHWN------ASTAAIAARFFATMAYNVGQQWASEILPTVLRGQG 461
            ::...|.|...:||   :|.|.|:      .:|.::...|.:..:..:....|:|::||.:||:|
  Rat   367 ILLLSMTLTGIASL---VLLGLWDYLNDAAITTFSVLGLFSSQASAILSTLLAAEVIPTTVRGRG 428

  Fly   462 LAIINIMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIGALIILFLPETKGATMPQTLDEAE 524
            |.:|..:|.:|.|..|.......:...|...::...:::..|.|:.|||||...:|:.|.:.|
  Rat   429 LGLIMALGALGGLSCPAQRLHMGHGAFLQHVVLAACALLCILSIMLLPETKRKLLPEVLRDGE 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 99/446 (22%)
MFS 141..509 CDD:119392 86/404 (21%)
Slc22a17NP_803156.2 MFS 106..476 CDD:119392 86/400 (22%)
2A0114 111..475 CDD:273326 85/394 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.