DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and T05A1.5

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:239 Identity:54/239 - (22%)
Similarity:107/239 - (44%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 YESIATEYNWVCDKRDFGTYSVVVYFVG-CIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSV 185
            :.::..|:|......|.|..:..::|:| .|:|.: :....|..||.|.|..:...|.:.|..:.
 Worm   120 FVTVQNEFNITKTLIDPGEMTSSIFFLGNGILGQI-YAVAADRIGRRPVLIASLFISGLSGIGAA 183

  Fly   186 VCKDFPCFAASRFVAGLSMNYCFVPI----YILTLENV---GIKYRTLVGNLALTFFFTLGACLL 243
            ....|......||..|    .||..:    :::..|::   |..|.:::..|.    :.:|.|.:
 Worm   184 YAPTFEIMLIGRFFQG----SCFTALTMINWVMCCESISFSGHGYASVLFGLC----WVIGYCSV 240

  Fly   244 PWLAYVISNWRHYAMVVALP-IVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKIISE 307
            ..||...|.||:..:..::| ::|.||.....|||.|:|::..|.|..::.::.|::..    :|
 Worm   241 SPLAMYFSTWRYVQLATSVPCVLFGILMMFTLPESFSFLVAKRKRDDLVKWIEMASRVG----NE 301

  Fly   308 EVWSEMRECYELKFANEQLGKQYTSLDLFKTFPRLVVLTILIVT 351
            |:..:..:..::....|.      :..|.:|. :||:.:.|:||
 Worm   302 EIDYDADQIVDMSSREED------NESLLQTL-KLVLQSKLMVT 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 54/239 (23%)
MFS 141..509 CDD:119392 50/220 (23%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 36/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.