DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and B0252.3

DIOPT Version :9

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001021888.1 Gene:B0252.3 / 174130 WormBaseID:WBGene00015088 Length:484 Species:Caenorhabditis elegans


Alignment Length:424 Identity:102/424 - (24%)
Similarity:191/424 - (45%) Gaps:53/424 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IATEYNWVCDKRDFGTYSVVVYFVGCIVGCLCFGFITDHSGRLPALFLANSCSM-IGGCVSVVCK 188
            :|.|::...|.......:...|.||.::|.:....:.||.|||| :|:|....| :||.:|....
 Worm    79 VADEFDLTGDASWLAESTTTFYMVGNMIGGMFIPPLADHYGRLP-VFVATVLLMAVGGMISAFST 142

  Fly   189 DFPCFAASRFVAGLSMNYCFVPIYILTLENVGIKYRTLVGNLALTFFFT---------LGACLLP 244
            ....|...|.:.|:......:..::|..||..::.|          |||         :|||.|.
 Worm   143 SIMMFCIMRMIHGIFYTAAGLAGWVLGYENTPLRLR----------FFTSVYFGVMWVVGACFLG 197

  Fly   245 WLAYVISNWRHYAMVVALPIVFM-ILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKIISEE 308
            .|||::.:||:....:::|.:|: :|..:..|||..:|:|..:.::....:::.....|.|.:.:
 Worm   198 LLAYILPDWRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEKIEAWLEKIRGPKGDISASD 262

  Fly   309 VWSEMRECYELKFANEQLGKQYTSL--DLFKTFPRLVVLTILIVT--WMTVALAYDAHVRVVEIL 369
            :..:          .::.|..:.:|  :::|  .::.::.:|::|  |:.....|.........|
 Worm   263 IVED----------RDENGSSFKTLCREMWK--HKMFIVYVLVMTYIWIVDTFIYFGLAFYSTNL 315

  Fly   370 DTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKPMMSAVMLLCAASSLFVGILKG-------HWNA 427
            ..::::.|.|.||||.||.|...:.:::.|||.::|...::...|  |:||:..       .|..
 Worm   316 AGNLYLNFVLMSLVEAPAYIFSPIFMNKYGRKVLISGTHIIAGLS--FLGIVLSSEAWHIHFWLL 378

  Fly   428 STAAIAARFFATMAYNVGQQWASEILPTVLRGQGLAIINIMGQMGALLSPLVLSTHRYYRPLPMF 492
            ...||:..|.:...:      ||||.||..|.:.:.....:.:.|.:|||.:......:...|..
 Worm   379 GKFAISCSFMSIYMF------ASEIFPTDGRNKCIGFCETLSRFGGMLSPYLSHLTAVHALAPAI 437

  Fly   493 IITLVSVIGALIILFLPETKGATMPQTLDEAEKR 526
            .::|::|.|.|:.|.||||....:|.|:.|...|
 Worm   438 TLSLIAVSGGLLTLILPETLNTKLPSTIAETASR 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 2A0119 17..519 CDD:273328 99/415 (24%)
MFS 141..509 CDD:119392 91/389 (23%)
B0252.3NP_001021888.1 MFS 87..454 CDD:119392 92/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.