DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5592 and LOC1277194

DIOPT Version :10

Sequence 1:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_316638.4 Gene:LOC1277194 / 1277194 VectorBaseID:AGAMI1_010343 Length:720 Species:Anopheles gambiae


Alignment Length:200 Identity:44/200 - (22%)
Similarity:86/200 - (43%) Gaps:49/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSATQLFSPQCIQATKALRMKKVQELVNFL-----------SESCEREEAVDISHVSFVTALNII 58
            :|..|:...:.:....||...:||||...|           :|.|        ||:: :..:::.
Mosquito   100 MSIWQVTQLKLVTTVSALTRSEVQELTKMLEPMGGTVTSNWTEEC--------SHLT-MNEVSVT 155

  Fly    59 SNILFSVNLGSYDSKNSSAFQ--EMVIGYQESI----GNPDLANFFPFMRFLDLQGNSKKMRESS 117
            ..:|.::    .::|....|.  ..::...:||    |.|...::.|  ..:|:....::.|..:
Mosquito   156 VKLLHAM----LENKPIVTFPYWRKMLQAAQSIHVKEGWPQPEDYQP--TNIDVTWRPERTRLFA 214

  Fly   118 GRLLQVF--REFYD--ARIVEKSSRSVEKDVSS---KDFL---DVL----IDLQQGDETEINIDE 168
            |:.. ||  |:.:|  ..:|:|:..:. ||::|   |.||   ||:    :...|...|| :|:.
Mosquito   215 GKTF-VFMNRKHFDMYGSVVQKAGATC-KDINSGVRKTFLTKSDVIVIQYVPSSQSQATE-SINS 276

  Fly   169 IEHLL 173
            |:.:|
Mosquito   277 IQDIL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5592NP_647996.1 MFS_SLC22 113..509 CDD:340875 21/74 (28%)
LOC1277194XP_316638.4 2A0119 111..632 CDD:273328 41/188 (22%)

Return to query results.
Submit another query.