DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf133 and HRD1

DIOPT Version :9

Sequence 1:NP_937894.1 Gene:Rnf133 / 386611 MGIID:2677436 Length:339 Species:Mus musculus
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:39/169 - (23%)
Similarity:65/169 - (38%) Gaps:23/169 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse   180 WK--RLTRELKKAFGQLQVRVLKEGDEEVNPNADSCVICFE--AYKPNEIV--------RILTCK 232
            ||  |..::|......:.|..|:....:.|    .|:||.:  .:.||:..        :.|.|.
Yeast   318 WKIWRNNKQLDDTLVTVTVEQLQNSANDDN----ICIICMDELIHSPNQQTWKNKNKKPKRLPCG 378

Mouse   233 HFFHKNCIDPWILAHGTCPMCKCDILKALG--IQMDIEDGTDSLQVLMSNELPGTLSPVEEETN- 294
            |..|.:|:..|:....|||:|:..:....|  :|......:|........:..|..:..:...| 
Yeast   379 HILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANE 443

Mouse   295 YELPPARTSSKVTHVQEHPTSSANAGSQPPEAEETSHPS 333
            .:|.|.||:|  ..::..||.  |..:.......||.||
Yeast   444 VDLLPTRTTS--PDIRIVPTQ--NIDTLAMRTRSTSTPS 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf133NP_937894.1 PA_GRAIL_like 43..159 CDD:239037
zf-RING_2 211..254 CDD:290367 14/52 (27%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 39/169 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.