Sequence 1: | NP_937894.1 | Gene: | Rnf133 / 386611 | MGIID: | 2677436 | Length: | 339 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_593372.1 | Gene: | SPAC57A7.09 / 2542187 | PomBaseID: | SPAC57A7.09 | Length: | 372 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 232 | Identity: | 49/232 - (21%) |
---|---|---|---|
Similarity: | 79/232 - (34%) | Gaps: | 89/232 - (38%) |
- Green bases have known domain annotations that are detailed below.
Mouse 104 LIERGGCAFTQKIKVASEHGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNIKAYFTFYHIR 168
Mouse 169 RLWVARIE-NRRWKRLT---RELKKAFGQ---------------------------LQVR----- 197
Mouse 198 ------------------VLKEG----DEEVNPNADS-------------------CVICFEAYK 221
Mouse 222 PNEIVRILTCKHFFHKNCIDPWILAH-GTCPMCKCDI 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rnf133 | NP_937894.1 | PA_GRAIL_like | 43..159 | CDD:239037 | 14/54 (26%) |
zf-RING_2 | 211..254 | CDD:290367 | 18/62 (29%) | ||
SPAC57A7.09 | NP_593372.1 | COG5540 | 1..369 | CDD:227827 | 49/232 (21%) |
Peptidases_S8_S53 | <144..211 | CDD:299169 | 20/75 (27%) | ||
zf-RING_2 | 320..362 | CDD:290367 | 18/41 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4628 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |