DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf133 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_937894.1 Gene:Rnf133 / 386611 MGIID:2677436 Length:339 Species:Mus musculus
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:49/232 - (21%)
Similarity:79/232 - (34%) Gaps:89/232 - (38%)


- Green bases have known domain annotations that are detailed below.


Mouse   104 LIERGGCAFTQKIKVASEHGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNIKAYFTFYHIR 168
            |::||.|.:..|...|...|.:|||:      |:...|.|.:     :..|:...|...:..||.
pombe   146 LVQRGKCTYFDKALEAQRLGFKGVIV------GDNRSPSSFR-----LHYMVAPDKVDESKVHIP 199

Mouse   169 RLWVARIE-NRRWKRLT---RELKKAFGQ---------------------------LQVR----- 197
            .|:|:... |..|..|.   |:..|.:.:                           |.:|     
pombe   200 SLFVSTSSYNLLWSDLLHSYRQPLKLYAKPEELGDMFWPFLLCFSPSIIMLITVQALAIRKFIRT 264

Mouse   198 ------------------VLKEG----DEEVNPNADS-------------------CVICFEAYK 221
                              :.:||    :||:..:..:                   ||||.|::.
pombe   265 YRTKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLESFT 329

Mouse   222 PNEIVRILTCKHFFHKNCIDPWILAH-GTCPMCKCDI 257
            ..:.|..|.|||.||:.||..||:.: ..||.|..::
pombe   330 KGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf133NP_937894.1 PA_GRAIL_like 43..159 CDD:239037 14/54 (26%)
zf-RING_2 211..254 CDD:290367 18/62 (29%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 49/232 (21%)
Peptidases_S8_S53 <144..211 CDD:299169 20/75 (27%)
zf-RING_2 320..362 CDD:290367 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.