DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13287 and prdm8

DIOPT Version :9

Sequence 1:NP_001261454.1 Gene:CG13287 / 38660 FlyBaseID:FBgn0035643 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_998575.1 Gene:prdm8 / 406719 ZFINID:ZDB-GENE-040426-2747 Length:502 Species:Danio rerio


Alignment Length:336 Identity:100/336 - (29%)
Similarity:152/336 - (45%) Gaps:73/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 QRYPQISIRSPRVYDDPSVVIPLVDSPEAPSTSS-------------PPPPMRSAF---TKVASS 185
            |:.|::. |..:|.|..::...|.|...:.|:..             .|...::..   |.:.:.
Zfish   187 QQKPEVK-RHRKVIDFHNIARDLEDKMNSSSSEDTTILRKRKQEPFLTPKSKKTVLLEKTNITNE 250

  Fly   186 SLSTSSSSPSTTSR-LESPVDAGAPPLSPDQLSCHSISPPLVTPPPRTNSGGQNPNPLPANPIVY 249
            |.:|:::......| |..|.|..  ..:..::|.:|....:...|       :.|||..::..: 
Zfish   251 SNTTNANKDCRAFRDLSEPTDNA--QTNESKISKNSAFTEVRKAP-------EPPNPEKSSRDI- 305

  Fly   250 HNFRPE--YQFN-GAFQAVNPMQALQAQQRL-----KQQLLYTRPPGPGNPNGGGPTMQANSPPG 306
              ..||  .|.| .||..|.|..|...|:..     |:.|...:.|.|.:.:....:.::.|..|
Zfish   306 --MAPEVGLQSNCSAFSFVVPKSARSEQKSAFCEPSKRALAEAQNPSPPDTDNSLDSFKSKSSLG 368

  Fly   307 P---------PSEFLHAYPG--------------FAPPPHPFAVSQPLQNPAAAAILSTLIPPTL 348
            .         |::...::.|              :||.....|:...||:.::.    ||:||  
Zfish   369 YRNVLASHLFPTDLAGSHAGGGMSAPLTSGGSYYYAPEHWTRAIGGQLQSTSSL----TLLPP-- 427

  Fly   349 ASTFT---LTAQNVCAKCNISFRMTSDLVYHMRSHHKSEVACDPN-RRKREEKLRCPVCQETFRE 409
              |||   ::.||.|||||:|||||||||:|||||||.|.|.:.. ||:|||||.||:|.|.|||
Zfish   428 --TFTPLGVSVQNWCAKCNLSFRMTSDLVFHMRSHHKKEFAAEAQVRRRREEKLTCPICHEYFRE 490

  Fly   410 RHHLTRHMTAH 420
            ||||:||||:|
Zfish   491 RHHLSRHMTSH 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13287NP_001261454.1 C2H2 Zn finger 360..380 CDD:275368 17/19 (89%)
zf-C2H2_2 363..>418 CDD:289522 40/55 (73%)
C2H2 Zn finger 400..420 CDD:275368 15/19 (79%)
prdm8NP_998575.1 SET 32..129 CDD:279228
C2H2 Zn finger 440..460 CDD:275368 17/19 (89%)
C2H2 Zn finger 481..501 CDD:275368 15/19 (79%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006844
OrthoInspector 1 1.000 - - otm25623
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16516
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.