DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT15 and Ppi1

DIOPT Version :9

Sequence 1:XP_011523086.1 Gene:KRT15 / 3866 HGNCID:6421 Length:463 Species:Homo sapiens
Sequence 2:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster


Alignment Length:341 Identity:61/341 - (17%)
Similarity:123/341 - (36%) Gaps:113/341 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    97 DGGLLSGNEK-------ITMQNLNDRLASYLDKVRALEEANADL--------EVKIHDWYQKQ-- 144
            ||.|..|.|:       :.:|:|:....|.:|.......::.::        |.:..|.:|.|  
  Fly   242 DGRLAGGQERGCFPNMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDS 306

Human   145 ---------------------------TPTSPECDYSQYFKTI-----------EELRDKIMATT 171
                                       .|..|...:|...|.:           :....::....
  Fly   307 PPRLIDMAGPYPVYSCPNVDDDCVTFEPPAGPATQFSSCQKNVLGEGNANRLCQKHSSPRLRQMH 371

Human   172 IDNSR--VILEIDNA---RLAA---------DDFRLKYENELALRQGVEADINGLRRVLDELTLA 222
            |.|:|  |:...|.:   ::||         .:|:.:..:|.|..|.:         :||.    
  Fly   372 ISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEFKERPYDEQATAQQI---------LLDH---- 423

Human   223 RTDLEMQIEGLNEELAYLK---KNHEEWVPPILQE-----MKEF---------SSQLAGQ----- 265
               ||..:|.|:.::..::   .|.|..||....|     :|::         |:..|.|     
  Fly   424 ---LENPVENLSFDMGSVEGCSANEEHGVPEPTSEAFEAIVKDYQLLRRSIRESNTKATQSATKN 485

Human   266 VNVEMDAAPGVDLTRVLAEMREQYEA-MAEKNRR--DV--EAWFFSKTEELNKEVASNTEMIQTS 325
            ...:..:|...||.:|..|:|:.:.. .|::|::  |:  ||...:|:.:.:|...::.|..:..
  Fly   486 PTAQEGSAQPQDLAKVFTELRDLFNVKAADENQKIQDICAEACALAKSHKKSKNRPASPERTKAG 550

Human   326 KTE-ITDLRRTMQELE 340
            ||: :.|...|.::::
  Fly   551 KTDPVEDACETPRKMK 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT15XP_011523086.1 Filament 104..423 CDD:278467 57/334 (17%)
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 9/51 (18%)
DUF4776 371..848 CDD:292622 44/212 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.