DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Slc27a1

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_006253015.1 Gene:Slc27a1 / 94172 RGDID:620927 Length:649 Species:Rattus norvegicus


Alignment Length:535 Identity:110/535 - (20%)
Similarity:198/535 - (37%) Gaps:118/535 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PKLIAQISITEDIVLTREDLHMNAMRVASYMRNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGTP 115
            |:.:|.:..:..|..|...|...:..||:....:|....|:|.|               |..|.|
  Rat    93 PERLALVDASSGICWTFAQLDTYSNAVANLFLQLGFAPGDVVAV---------------FLEGRP 142

  Fly   116 --------------LHALHNAY-----------EEACIAKLFG-------------ITKPRLIFC 142
                          :.||.|..           ..|..|.::|             :.|..|.||
  Rat   143 EFVGLWLGLAKAGVVAALLNVNLRREPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGKSLLKFC 207

  Fly   143 DGDEYEKVKSATKDLQVTIVTMRNHPRGSVRIQDVLTTPVMQNFQPLRLKDGIDHTLAILSSSGT 207
            .||  ...:|...|.|:....:...|          |||:.|  .|.:   |:|..|..:.:|||
  Rat   208 SGD--LGPESVLPDTQLLDPMLAEAP----------TTPLAQ--APGK---GMDDRLFYIYTSGT 255

  Fly   208 SGFPKAVTISNS--HKIIV----DYMAINNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIADCD 266
            :|.|||..:.:|  ::|..    .| ::..:::.|....|...:|..|.:...:....:::....
  Rat   256 TGLPKAAIVVHSRYYRIAAFGHHSY-SMRANDVLYDCLPLYHSAGNIMGVGQCIIYGLTVVLRKK 319

  Fly   267 FDPGLFCRAIGKYRISMVLLSSSYLAIFANCPEFESADLSSLNYV-IFGGSSCSLEVQRKVRSRL 330
            |....|.....||..::|.............|   ..|:...::| :..|:.....:..:...|.
  Rat   320 FSASRFWDDCVKYNCTVVQYIGEICRYLLRQP---VRDVERRHHVRLAVGNGLRPAIWEEFTQRF 381

  Fly   331 SHDCLNFCYGLTELNSAGSVNLNFDEKPNSVG---------RAIRGIKIK------VIDEQG--- 377
            ....:...||.||.|.:.:   |.|.|..|.|         ..||.:|:.      :.|.||   
  Rat   382 GVRQIGEFYGATECNCSIA---NMDGKVGSCGFNSRILTHVYPIRLVKVNEDTMEPLRDSQGLCI 443

  Fly   378 --EAQEPN-VVGEICFHNSQ----KWAGYYKNPDETRQIQDS-----ENWIHTGDLGYVDKDGYL 430
              :..||. :||:|   |.|    ::.||..:....::|..|     ::...:||:..:|:.||:
  Rat   444 PCQPGEPGLLVGQI---NQQDPLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLVMDELGYM 505

  Fly   431 FVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLVKKPGTQLEAQD 495
            :..||..|..:::......:|:|.|::.:....:..|:|:..|....:|..:.:..|..||:...
  Rat   506 YFRDRSGDTFRWRGENVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADPHNQLDPNS 570

  Fly   496 VVEYVRKRITAKFKQ 510
            :.:.::| :.|.:.|
  Rat   571 MYQELQK-VLASYAQ 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 110/535 (21%)
AFD_class_I 55..530 CDD:302604 109/531 (21%)
Slc27a1XP_006253015.1 PRK08279 45..649 CDD:236217 110/535 (21%)
AFD_class_I 107..614 CDD:302604 107/521 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.