DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and BZO1

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_176763.1 Gene:BZO1 / 842900 AraportID:AT1G65880 Length:580 Species:Arabidopsis thaliana


Alignment Length:521 Identity:114/521 - (21%)
Similarity:217/521 - (41%) Gaps:80/521 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RVASYMRNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGTPLHALHNAYEEACIAKLFGITKPRLI 140
            |:|:.:.::.:.:.|:|.||..:|.....:.:|....|..|:.::...:...||.:....||:::
plant    51 RLAASLISLNISKNDVVSVMAPNTPALYEMHFAVPMAGAVLNPINTRLDATSIAAILRHAKPKIL 115

  Fly   141 FCD-------GDEYEKVKSATKDLQVTIVTMRNH---PRGSVR-------IQDVLTTPVMQNFQP 188
            |.|       .:....:.|...:|.:.::.:..:   .|.|..       ||....||.|. .:.
plant   116 FLDRSFEALARESLHLLSSEDSNLNLPVIFIHENDFPKRASFEELDYECLIQRGEPTPSMV-ARM 179

  Fly   189 LRLKDGIDHTLAILSSSGTSGFPKAVTISNSHKIIVDYMAINNSNIQYTSSTLD---W------C 244
            .|::|..| .:::..:|||:..||.|.||:....:....||    |.:...|..   |      |
plant   180 FRIQDEHD-PISLNYTSGTTADPKGVVISHRGAYLCTLSAI----IGWEMGTCPVYLWTLPMFHC 239

  Fly   245 SGLSMAITSGVFSTTSIIADCDFDPGLFCRAIGKYRISMVLLSSSYLAIFANCPEFESADLSSLN 309
            :|.:....:.....||:.......|.:: :.|..:.::.:....:...|.......:.:..|...
plant   240 NGWTFTWGTAARGGTSVCMRHVTAPEIY-KNIEMHNVTHMCCVPTVFNILLKGNSLDLSPRSGPV 303

  Fly   310 YVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSV--------------NLNFDEKPNS 360
            :|:.|||.....:.:||: ||....:: .||.||  :.|.:              |...:.|...
plant   304 HVLTGGSPPPAALVKKVQ-RLGFQVMH-AYGQTE--ATGPILFCEWQDEWNRLPENQQMELKARQ 364

  Fly   361 VGRAIRG---IKIKVIDEQGEA-QEPNVVGEICFHNSQKWAGYYKNPDETRQIQDSENWIHTGDL 421
             |.:|.|   :.:|..:.|..| ::...:|||....|....||.|||..|.: .....|::|||:
plant   365 -GISILGLADVDVKNKETQKSAPRDGKTMGEILIKGSSIMKGYLKNPKATFE-AFKHGWLNTGDV 427

  Fly   422 GYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLV-K 485
            |.:..||::.:.||.||::..........|:|||:.:.|.|||..|..:..|..|:...|.:| :
plant   428 GVIHPDGHVEIKDRSKDIIISGGENISSVEVENVLYKYPKVLETAVVAMPHPTWGETPCAFVVLE 492

  Fly   486 KPGT----------QLEAQDVVEYVRKRI-----TAKFKQLNGGALIVDQIVRSGNRKTNRSAVK 535
            |..|          |...::::||.|:.:     ..|       .:.::::.::||.|..:..::
plant   493 KSETTIKEDRVDKFQTRERNLIEYCRENLPHFMCPRK-------VVFLEELPKNGNGKILKPKLR 550

  Fly   536 E 536
            :
plant   551 D 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 114/521 (22%)
AFD_class_I 55..530 CDD:302604 114/513 (22%)
BZO1NP_176763.1 PLN03102 1..580 CDD:215576 114/521 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.