DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Slc27a5

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_077057.1 Gene:Slc27a5 / 79111 RGDID:708535 Length:690 Species:Rattus norvegicus


Alignment Length:401 Identity:88/401 - (21%)
Similarity:154/401 - (38%) Gaps:88/401 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 PLRLKDGI--DHTLAILSSSGTSGFPKAVTISNSHKIIVDYMAINNSNIQYTSSTLDWCSGL--- 247
            |.:|:..|  ......:.:|||:|.||...:  ||:.::.           .|:.|.:|...   
  Rat   277 PAKLRANIKWKSPAIFIYTSGTTGLPKPAIL--SHERVIQ-----------MSNVLSFCGRTADD 328

  Fly   248 ----------SMAITSGVFSTTSIIADCDFDPGLF-------CRAIGKYRISMVLLSSSYLAIFA 295
                      ||.:..||.....:.|.|...|...       ||   :|.:::||.....|....
  Rat   329 VVYNVLPLYHSMGLVLGVLGCLQLGATCVLAPKFSASRYWAECR---QYSVTVVLYVGEVLRYLC 390

  Fly   296 NCPEFESADLSSLNYVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVNL-NFDEKPN 359
            |.|........::.:.:  |:....:|....:.|.....:...||.||    |:|.| |:.....
  Rat   391 NVPGQPEDKKHTVRFAL--GNGLRADVWENFQQRFGPIQIWELYGSTE----GNVGLMNYVGHCG 449

  Fly   360 SVGRAIRGIKI---------------KVIDEQG-----EAQEPNVVGEICFHNSQKWAGYYKNPD 404
            :||:....|::               .|.|:||     |..:|.:: ......:|.:.||..:.|
  Rat   450 AVGKTSCFIRMLTPLELVQFDIETAEPVRDKQGFCIPVETGKPGLL-LTKIRKNQPFLGYRGSQD 513

  Fly   405 ET--------RQIQDSENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPN 461
            ||        ||:.|.  :.:|||:..:|::|:.:..|||.|..:::.......|:|.|::.:..
  Rat   514 ETKRKLVANVRQVGDL--YYNTGDVLALDQEGFFYFRDRLGDTFRWKGENVSTREVEGVLSILDF 576

  Fly   462 VLEACVFGIWDP-VNGDEAAASLVKKPGTQLEAQDVVEYVRK-----------RITAKFKQLNGG 514
            :.|..|:|:..| ..|....|::...||...:.|.:.::||.           ||....:..|..
  Rat   577 LEEVNVYGVTVPGCEGKVGMAAVKLAPGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTY 641

  Fly   515 ALIVDQIVRSG 525
            .|:..|:.|.|
  Rat   642 KLVKSQLAREG 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 88/401 (22%)
AFD_class_I 55..530 CDD:302604 88/401 (22%)
Slc27a5NP_077057.1 PRK08279 101..690 CDD:236217 88/401 (22%)
AFD_class_I 140..680 CDD:302604 88/401 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.