DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and ACSM3

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_024306135.1 Gene:ACSM3 / 6296 HGNCID:10522 Length:633 Species:Homo sapiens


Alignment Length:450 Identity:110/450 - (24%)
Similarity:174/450 - (38%) Gaps:103/450 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 EKVKSATKDLQVTIVTMRN-----------------HPRGSVRIQDVLT---TPVMQNFQPLRLK 192
            :.|.|..::|...::...|                 ||..|...:..||   |.::|..  |.|.
Human   182 DAVASKCENLHSKLIVSENSREGWGNLKELMKVFLCHPGWSTVARSWLTATSTSLVQAI--LSLL 244

  Fly   193 DGID-------HT---------LAILSSSGTSGFPKAVTISNSHKIIVDYMAINN--------SN 233
            ...|       ||         :||..:|||||:||..  :::|......:::|.        |:
Human   245 SSWDYRHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMT--AHTHSSFGLGLSVNGRFWLDLTPSD 307

  Fly   234 IQYTSSTLDWCSGLSMAITSGVFSTTSIIADC-------DFDPGLFCRAIGKYRISMVLLSSSYL 291
            :.:.:|...|    :.:..|.|||.. |...|       .|:|....:.:.||.|:         
Human   308 VMWNTSDTGW----AKSAWSSVFSPW-IQGACVFTHHLPRFEPTSILQTLSKYPIT--------- 358

  Fly   292 AIFANCP---------EFESADLSSLNYVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTEL--- 344
             :|.:.|         :..|....||.:.:..|...:.:|..|.|::...|... .||.||.   
Human   359 -VFCSAPTVYRMLVQNDITSYKFKSLKHCVSAGEPITPDVTEKWRNKTGLDIYE-GYGQTETVLI 421

  Fly   345 --NSAGSVNLNFDEKPNSVGRAIRGIKIKVIDEQGEAQEPNVVGEICFHNSQK-----WAGYYKN 402
              |..|     ...||.|:|:......:|::|..|....|...|:|.......     :..|..|
Human   422 CGNFKG-----MKIKPGSMGKPSPAFDVKIVDVNGNVLPPGQEGDIGIQVLPNRPFGLFTHYVDN 481

  Fly   403 PDETRQIQDSENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACV 467
            |.:|...... |:..|||.||:|||||.:.:.|..|::........|.|:||.:.|.|:|.|:.|
Human   482 PSKTASTLRG-NFYITGDRGYMDKDGYFWFVARADDVILSSGYRIGPFEVENALNEHPSVAESAV 545

  Fly   468 FGIWDPVNGDEAAASLVKKPGTQLEAQ-----DVVEYVRKRITAKFK-QLNGGALIVDQI 521
            ....||:.|:...|.:|..|..:...|     ::.|:| |:.||.:| ....|.||:..|
Human   546 VSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIKEIQEHV-KKTTAPYKYPRKVGILIITNI 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 109/449 (24%)
AFD_class_I 55..530 CDD:302604 109/449 (24%)
ACSM3XP_024306135.1 AFD_class_I 54..596 CDD:327384 106/440 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.