DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and ACSS2

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_011527207.1 Gene:ACSS2 / 55902 HGNCID:15814 Length:737 Species:Homo sapiens


Alignment Length:400 Identity:83/400 - (20%)
Similarity:145/400 - (36%) Gaps:80/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LAILSSSGTSGFPKAVT---------ISNSHKIIVDYMAINNSNIQYTSSTLDWCSGLSMAITSG 254
            |.||.:||::|.||.|.         ::.:.|.:.|:.|   .::.:.::.:.|.:|.|. :|.|
Human   337 LFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHA---EDVFWCTADIGWITGHSY-VTYG 397

  Fly   255 VFS--TTSIIADCDF-------DPGLFCRAIGKYRISMVLLSSSYLAI---FANCP--EFESADL 305
            ..:  .||::    |       |.......:.||:::....:.:.:.:   |.:.|  :...|.|
Human   398 PLANGATSVL----FEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASL 458

  Fly   306 SSLNYV--------------IFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVNLNFDE 356
            ..|..|              :.|...|.: |....::......|....|.|.:            
Human   459 QVLGTVGEPINPEAWLWYHRVVGAQRCPI-VDTFWQTETGGHMLTPLPGATPM------------ 510

  Fly   357 KPNSVGRAIRGIKIKVIDEQGEAQEPNVVGEICFHNSQKWAGYYKNP--------------DETR 407
            ||.|......|:...:::|.||..|....|.:.......|...:|.|              .||.
Human   511 KPGSATFPFFGVAPAILNESGEELEGEAEGYLLLRTETSWLEVFKQPWPGIMRTVYGNHERFETT 575

  Fly   408 QIQDSENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWD 472
            ..:....:..|||....|:|||.::..|:.|||.....:...:|:|:.:.|...|.||.|.|...
Human   576 YFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPH 640

  Fly   473 PVNGDEAAASLVKKPGTQLEAQDVVEYVRKRITAKFKQLNGGALIVDQIVRS--GNRKTNRSAVK 535
            ||.| |.....|........:..:.|.::|:|..|.     |.:.....:::  |..||....:.
Human   641 PVKG-ECLYCFVTLCDGHTFSPKLTEELKKQIREKI-----GPIATPDYIQNAPGLPKTRSGKIM 699

  Fly   536 EHFLKNYNNN 545
            ...|:....|
Human   700 RRVLRKIAQN 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 82/394 (21%)
AFD_class_I 55..530 CDD:302604 80/383 (21%)
ACSS2XP_011527207.1 PRK00174 31..728 CDD:234677 82/399 (21%)
ACS 51..721 CDD:213313 82/399 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.993157 Normalized mean entropy S690
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.