DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Fatp2

DIOPT Version :10

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_995925.2 Gene:Fatp2 / 37657 FlyBaseID:FBgn0265187 Length:714 Species:Drosophila melanogaster


Alignment Length:110 Identity:27/110 - (24%)
Similarity:40/110 - (36%) Gaps:25/110 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 IEEDDIDSFEPEV-LGLMKQMNYNPCL----RVSEKSK------AEGVGTNNSNPQVDTTEQE-- 323
            |.|.|.|:.:|.: .|.:..:.||..|    |...:||      .|..|...|...:..:.|.  
  Fly    10 ITESDADTDKPRMRYGELVILGYNGFLPQGDRGRRRSKFVLYKRTESNGVKRSKHYIVQSPQSSQ 74

  Fly   324 ---DAGNMELEF----EQGLIDTYSDLFAEMNPDTDFIADGLDLE 361
               ||....:.:    .|.:|..|.:     :||||....|...|
  Fly    75 AILDAKQHSISYTLSRNQAVIVEYKE-----DPDTDMFQVGRSSE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 Firefly_Luc_like 55..530 CDD:341237 27/110 (25%)
Fatp2NP_995925.2 Adenylate forming domain, Class I superfamily 163..680 CDD:473059
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.